Details for Lyrate rockcress Locus 16056572

Position : sca3 ( 5`- 4049520 .. 4047818 -3` )
Annotation : [B2G] atpap16 pap16
External links : CoGe
PGDD synteny : 16056572

Protein [Map View]
MKKPSLFLIILVLSIPTTVGNLRVREGSTFKMAIFADLHFGEDTWTDWGPRQDVNSVNVMSAVLDAETPDFVVYLGDVVT
ANNIAIQNASLFWDKAISPTRDRGIPWATLFGNHDDASFLWPLDWFSSSGIPPIRCPAASDDDGCAFRGTTRVELIREEI
KSSSALSYSMIGPKELWPSVSNYVLLVESSDHSKPPVAILYFLDSGGGSYPEVISNAQVEWFKTMSNTLNPDLRIPELIF
WHIPSKAYKKVAPRLWITKPCVGSINKEKVAAQEAENGMMRVLENRSSVKAVIVGHNHGLDWCCPYKDKLWLCFARHTGY
GGYGNWPRGSRILEISEMPFRIKTWIRMEDGSVHSEVNLAYD*

DNA
ATGAAAAAACCGTCGTTGTTTCTGATCATTTTAGTGCTAAGCATACCGACGACGGTGGGCAATCTTCGGGTGCGGGAAGG
ATCAACGTTCAAGATGGCCATCTTTGCAGACCTCCACTTCGGTGAAGACACGTGGACTGATTGGGGTCCTCGTCAAGATG
TGAACTCCGTTAACGTTATGTCCGCCGTTCTCGACGCTGAAACTCCAGATTTTGTGGTCTACTTGGGAGATGTAGTAACG
GCTAACAACATAGCAATCCAAAACGCAAGCTTGTTTTGGGACAAAGCAATCTCTCCTACAAGAGACAGAGGCATTCCATG
GGCTACTCTCTTTGGTAACCACGACGATGCTTCTTTTCTTTGGCCTTTGGATTGGTTCTCTTCCTCCGGTATTCCTCCCA
TTCGCTGCCCTGCTGCATCGGATGATGATGGATGCGCGTTTAGAGGAACTACGCGAGTGGAATTGATTCGCGAAGAGATA
AAGTCATCCAGTGCACTCTCATACTCTATGATTGGTCCTAAGGAGCTATGGCCAAGCGTATCTAACTATGTCCTTCTTGT
TGAATCATCGGATCATTCAAAACCACCCGTGGCAATACTATACTTTCTTGATTCGGGCGGTGGTTCATACCCTGAGGTTA
TCTCAAATGCTCAAGTGGAATGGTTTAAAACCATGTCTAATACTCTTAATCCTGATTTAAGGATCCCAGAGTTGATATTT
TGGCACATACCTAGTAAAGCATACAAGAAAGTAGCCCCAAGGCTATGGATAACAAAACCTTGCGTTGGATCAATCAACAA
AGAGAAAGTTGCTGCTCAAGAAGCTGAAAATGGGATGATGAGAGTTCTTGAGAACAGATCCTCCGTTAAGGCAGTGATTG
TAGGACACAACCATGGACTAGACTGGTGCTGTCCGTACAAAGATAAACTCTGGCTTTGCTTTGCGAGACATACAGGTTAT
GGAGGATATGGAAATTGGCCAAGAGGATCAAGGATTTTGGAGATTTCTGAAATGCCCTTTCGTATTAAGACCTGGATTAG
GATGGAAGATGGATCTGTCCACAGTGAAGTTAATCTAGCATATGATTAG