Details for Lyrate rockcress Locus 16056567

Position : sca3 ( 5`- 10821743 .. 10819417 -3` )
Annotation : [B2G] mate efflux family protein
External links : CoGe
PGDD synteny : 16056567

Protein [Map View]
MAAPTSKDDHEGEGGREKSSTYVQQLIDVEEAKTQIIYSLPMIFTNLFYYCIPLTSVMFASHLGQLELAGATLANSWATV
TGFAFMTGLSGALETLCGQGFGAKSYRMLGIHLQSSCIVSLVFSILTTILWFFTESIFGLLRQDPSISKQAALYMKYLAP
GLFAYGFLQNILRFCQTQSIVTPLVVFSFVPLVINIGTTYALVHLAGLGFIGAPIATSISMWIAFVSLGIYVIWSDKFKE
TWTGFSMESFRYVVLNLTLSIPSAAMVCLEYWAFEILVFLAGLMPNPEITTSLVAICVNTESISYMLTCGLSAATSTRVS
NELGAGNVKGAKKATSVSVKLSLVLALGVVIAILVGHDAWVGLFSNSHVIKEGFASLRFFLAASITLDSIQGVLSGVARG
CGWQRFATVINLGTFYLIGMPISVLCGFKLKLHAKGLWIGLICGMFCQSSSLLLMTIFRKWIKLNAATV*

DNA
ATGGCTGCTCCTACGTCCAAAGATGACCATGAAGGTGAAGGAGGAAGAGAAAAATCATCAACTTATGTTCAACAACTTAT
TGACGTTGAAGAAGCAAAGACTCAAATCATTTACTCTCTACCAATGATATTCACCAATCTTTTCTATTATTGTATCCCTT
TAACCTCTGTGATGTTTGCTTCTCACCTCGGCCAACTCGAGCTCGCCGGTGCTACCCTCGCCAATTCTTGGGCTACCGTC
ACCGGTTTTGCCTTCATGACAGGGTTAAGTGGAGCACTTGAGACATTGTGTGGACAAGGCTTTGGTGCAAAAAGCTATAG
AATGTTGGGGATTCATCTTCAATCATCTTGCATCGTCTCATTAGTCTTCAGCATCCTCACCACCATCTTATGGTTCTTCA
CAGAATCGATTTTCGGACTTCTCAGACAAGATCCTAGCATCTCAAAACAAGCTGCACTCTATATGAAGTACCTAGCTCCC
GGTTTATTTGCTTATGGGTTCTTACAAAACATTTTGAGATTTTGCCAAACACAATCCATCGTTACTCCGCTAGTTGTCTT
CTCGTTTGTTCCCTTGGTGATTAATATTGGTACTACGTATGCTCTGGTGCATTTAGCTGGCCTCGGATTCATTGGAGCTC
CCATAGCTACATCTATTTCAATGTGGATAGCTTTCGTTTCTCTCGGAATTTACGTGATTTGGTCAGACAAGTTTAAGGAA
ACATGGACCGGATTTTCGATGGAATCATTTCGTTATGTAGTACTAAACTTGACATTAAGCATCCCTTCTGCTGCTATGGT
ATGTTTGGAATATTGGGCGTTCGAGATTCTAGTATTCTTGGCAGGACTCATGCCAAATCCGGAAATCACCACCTCTTTGG
TAGCTATATGCGTCAACACCGAATCGATTAGCTACATGTTAACATGCGGACTTAGCGCAGCTACAAGTACTCGTGTGTCG
AACGAACTTGGAGCAGGAAATGTAAAAGGCGCAAAGAAGGCGACTTCGGTGTCCGTTAAGTTGTCTTTAGTTCTAGCTCT
CGGTGTAGTGATTGCTATACTTGTAGGTCATGATGCTTGGGTTGGTTTATTCAGCAATAGCCATGTGATTAAAGAGGGAT
TTGCATCACTAAGGTTTTTCCTTGCTGCATCTATAACACTTGATTCCATCCAAGGTGTTTTATCAGGAGTTGCGAGAGGA
TGTGGATGGCAGCGGTTCGCCACGGTTATAAATTTGGGAACATTCTATTTAATTGGAATGCCGATTTCAGTCCTTTGTGG
TTTCAAGTTGAAGCTTCATGCCAAGGGTTTGTGGATCGGTCTGATATGTGGGATGTTTTGCCAATCCTCGTCTCTTCTGC
TTATGACAATTTTCCGGAAGTGGATAAAGCTGAATGCTGCTACTGTCTGA