Details for Lyrate rockcress Locus 16056509

Position : sca3 ( 5`- 6009201 .. 6007759 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897709 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056509

Protein [Map View]
MEQEDFYFPDTDLDLSFTSTTTDRTFASSSARTSLTLSFNDRLSTSSAVTTSSTSSSTVNHRRHDPHWSAIKSAKLLSSD
GNIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVIDRNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHY
TCLLIDYAPNGDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDV
VPTFKSRRYRRTSSSPSLRRRRSGCFSVAAEKKYEREEIVSEFAAEPVTAFSRSCVGTHEYLAPELVAGNGHGSGVDWWA
FGIFLYELLYGTTPFKGESKEQTLRNIVSTTKSASFHVDVDSEEARDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIK
WPLIRHYKPPEEVRGLVIKKSTRSHAGHVIAVSPRRRKSFLWRALSYLLRGKNSSGGSKNQSNSNYYHYVGKSYASRKRV
*

DNA
ATGGAACAAGAAGATTTCTATTTCCCTGACACCGATCTTGATCTCAGCTTCACATCCACCACCACCGACCGTACATTTGC
CTCCTCGAGCGCTCGCACAAGTCTAACATTAAGCTTCAACGACAGACTCTCCACTTCCTCCGCCGTAACAACCTCCTCCA
CATCCTCTTCCACCGTCAACCACCGTCGTCACGATCCTCACTGGTCAGCAATCAAATCAGCAAAACTTCTCTCCTCCGAT
GGAAACATCCACCTCCGTCACCTGAAACTTATACGCCACCTCGGCACAGGAAACCTAGGCCGAGTCTTCCTCTGCAACCT
CCGTGACTCCTCCGCAAGATTCGCCCTAAAGGTCATCGACCGTAACTGTCTCACGACGGAGAAGAAGCTCTCTCAGGTCG
AGACGGAGGCAGAGATCCTCTCCTTGCTAGACCACCCTTTCCTCCCTACGCTCTACGCTCGTATAGACGAGTCTCACTAC
ACGTGTCTCCTCATTGATTATGCACCAAACGGAGACTTACATTCCTTGTTACGCAAGCAACCTGGTAACCGTTTACCGAT
TCAGCCGGTTAGATTCTTCGCCGCCGAAGTTCTCGTCGCATTAGAGTACCTTCACGCAATGGGAATCGTATACCGCGATC
TTAAACCTGAAAACGTTTTGCTTCGTGAAGACGGTCACGTCATGTTGTCGGATTTTGATCTTTGTTTTAAATCCGACGTT
GTCCCTACCTTTAAATCTCGTCGGTACCGGAGAACTTCTTCGTCTCCGTCGCTTCGTAGGAGAAGGAGCGGTTGCTTCTC
CGTTGCTGCGGAGAAAAAGTACGAGAGAGAGGAGATCGTTTCGGAGTTTGCGGCAGAGCCTGTGACGGCGTTTTCAAGGT
CTTGCGTCGGAACACATGAGTACCTTGCACCGGAGCTAGTCGCCGGCAACGGACACGGAAGCGGAGTAGACTGGTGGGCG
TTTGGAATATTCCTTTACGAGTTGTTGTACGGAACGACGCCGTTTAAGGGAGAGAGTAAAGAGCAAACCCTGCGCAATAT
AGTATCGACCACTAAGTCCGCGAGTTTCCACGTGGACGTTGATTCAGAGGAAGCTAGGGATTTGATTGAGAAGCTTTTGG
TTAAGGACCCGAGGAAAAGGCTAGGATGCGCCAGGGGTGCGCAAGATATCAAACGTCATCCGTTTTTCGATGGAATCAAG
TGGCCGTTGATTAGGCATTATAAGCCACCGGAAGAAGTTAGAGGTCTTGTGATAAAGAAGTCAACGAGATCACATGCTGG
TCACGTGATTGCCGTTTCACCAAGACGGAGGAAGTCATTTTTGTGGAGGGCGTTGTCATATTTACTGCGCGGTAAAAACT
CTAGTGGTGGGAGTAAAAATCAGAGCAATAGTAATTACTATCATTATGTGGGCAAAAGCTACGCGAGTCGCAAACGCGTT
TAA