Details for Lyrate rockcress Locus 16056494

Position : sca3 ( 5`- 3384753 .. 3376494 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896987 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056494

Protein [Map View]
MAAANAPITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWITPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLTNNQII
NYKCSPNEKWLVLIGIAPGSPERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGSPVDY
NTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAVLANGMFTHYDRPRIAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDS
VWSQVAKAQLREGLVSDAIESFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIDRLGEI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGEHELAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELA
WINNMMDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGGGYGPP
PQMGGMPGMPPMPPYGMPPMGGY*

DNA
ATGGCTGCTGCCAACGCCCCCATCACGATGAAGGAGGTCCTGACGCTTCCTAGCGTCGGGATCAATCAGCAATTCATCAC
GTTTACAAATGTTACTATGGAGTCTGACAAGTACATCTGTGTACGAGAGACGTCACCGCAAAACAGTGTTGTAATTATAG
ATATGAATATGCCGATGCAGCCTCTAAGGAGACCTATTACCGCAGATTCTGCTCTTATGAACCCAAACTCGAGGATCCTT
GCCTTAAAAGCTCAAGTTCCAGGAACCACTCAGGATCATCTACAGATATTTAACATTGAAGCAAAAGCAAAGTTAAAATC
ACATCAGATGCCTGAGCAGGTTGTCTTTTGGAAGTGGATTACACCAAAGATGTTGGGGCTGGTCACACAGAATTCCGTCT
ATCATTGGTCAATTGAAGGCGATTCTGAGCCAGTTAAGATGTTTGATAGAACAGCCAATTTGACCAACAATCAAATTATA
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTTTTAATTGGAATTGCTCCTGGCTCTCCTGAGAGACAACAATTGGT
TAAAGGAAATATGCAGCTTTTCTCTGTGGATCAACAGCGGAGTCAGGCCCTTGAGGCACATGCTGCATCATTTGCGCAGT
TTAAGGTCCCTGGGAATGAGAATCCTTCTATTCTTATATCATTTGCAAGCAAGAGCTTTAATGCTGGGCAGATAACATCA
AAGTTGCATGTCATTGAACTTGGTGCCCAACCTGGAAAACCATCATTTACAAAAAAGCAAGCAGATCTCTTTTTCCCACC
TGATTTTGCTGATGATTTTCCTGTTGCCATGCAGGTCTCTCACAAATTTAACTTGATATATGTTATCACCAAACTTGGCC
TATTGTTTGTGTACGATCTAGAGACTGCTTCTGCTATCTACAGAAATCGGATTAGTCCAGACCCAATTTTCTTGACTTCT
GAAGCTTCCTCAGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCTACAGTAAACGAGGCTACCAT
TATACCTTTTATTAGTGGCCAATTGAACAATTTGGAGCTTGCTGTCAATCTTGCTAAAAGAGGAAACCTCCCAGGTGCAG
AAAATCTGGTTGTCCAGCGGTTCCAGGAGTTGTTCGCTCAAACAAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCT
CCTCAAGGAATTCTAAGGACACCTGATACAGTGGCCAAATTCCAGAGTGTTCCTGTACAAGCTGGGCAAACTCCTCCATT
GTTACAGTATTTTGGGACTCTTTTGACTAGAGGGAAGCTCAATTCATATGAGTCACTGGAACTATCTCGGCTGGTTGTGA
ACCAAAACAAGAAGAACCTCCTGGAAAACTGGTTGGCAGAGGATAAGCTAGAATGCAGTGAAGAACTTGGAGACCTTGTC
AAGACTGTTGATAATGATCTTGCTCTGAAAATATACATCAAAGCTCGGGCGACTCCAAAAGTTGTAGCAGCTTTTGCAGA
AAGAAGGGAGTTTGACAAAATATTGATTTACTCAAAGCAGGTTGGGTACACACCTGATTACCTGTTTCTTCTGCAAACCA
TACTCCGTACAGATCCTCAGGGAGCAGTAAATTTTGCATTAATGATGTCTCAAATGGAAGGAGGTTCTCCAGTTGACTAC
AACACCATCACTGATCTTTTTCTTCAGAGAAATCTGATCCGTGAAGCGACTTCTTTCCTTCTGGATGTGCTAAAGCCAAA
TTTACCTGAGCATGCTTTTCTGCAAACTAAGGTTCTGGAGATCAATTTGGTAACTTTTCCTAATGTGGCTGATGCGGTAT
TAGCAAATGGAATGTTCACTCACTATGACCGGCCTCGTATTGCTCAACTTTGTGAAAAGGCTGGACTTTATATCCAATCC
TTGAAGCATTACTCAGAGTTGCCTGATATAAAACGTGTAATTGTAAACACACATGCTATCGAGCCACAGGCTCTTGTTGA
GTTTTTTGGCACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAGGATCTGTTGCTGGTCAACCTGAGAGGCAATCTGC
AGATAATTGTTCAGGCTTGCAAGGAGTACTGTGAGCAACTTGGTGTTGATGCATGTATTAAGCTCTTTGAGCAGTTCAAG
TCATACGAAGGGCTATACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCTGAGATTCACTTCAAATACATTGA
AGCAGCTGCCAAGACTGGTCAAATAAAGGAGGTTGAGCGTGTAACTAGAGAGTCTAACTTCTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGAAGCTAAGCTGCCTGATGCACGACCTTTGATAAATGTCTGCGATCGTTTTGGCTTTGTGCCTGAT
CTTACTCATTACCTCTACACAAACAACATGCTTCGTTACATTGAAGGTTACGTACAGAAGGTGAACCCTGGGAATGCTCC
CTTAGTTGTTGGGCAGTTGCTTGATGATGAATGCCCCGAAGATTTTATAAAAGGCCTCATTCTCTCTGTTCGTTCATTGC
TTCCTGTTGAACCACTTGTCGAGGAATGTGAGAAGAGAAATCGACTCCGTCTCCTCACTCAGTTCTTGGAGCATTTAGTT
AGTGAGGGAAGCCAGGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAACAACAACCCTGAGCATTT
CCTGACCACCAACCCTTACTACGACTCTAAGGTCGTGGGTAAGTACTGCGAGAAACGTGATCCTACCCTGGCGGTTGTGG
CATACAGAAGAGGACAATGTGATGAGGAACTCATCAATGTCACTAACAAAAACTCTTTGTTCAAGTTACAAGCCAGGTAT
GTAGTGGAGAGGATGGATGGTGATCTCTGGGATAAGGTTCTCGATGAAAACAATGATTATAGAAGACAGCTTATTGACCA
AGTTGTTTCTACTGCTTTACCTGAAAGCAAGAGCCCGGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATT
TGCCGCACGAGCTTATTGAGCTTCTTGAAAAGATTGTTCTTCAAAATTCTGCCTTCAGTGGAAACTTCAATCTGCAAAAT
CTGCTTATATTGACAGCTATTAAGGCAGATCCATCTAGAGTTATGGATTACATTAACAGGCTGGACAACTTTGATGGACC
TGCGGTTGGAGAAGTCGCAGTTGAAGCCCAATTGTATGAGGAAGCATTTGCTATCTTCAAGAAGTTCAACTTAAATGTTC
AGGCTGTCAATGTATTGCTGGATAACGTCAGAAGCATTGAGCGTGCAGTTGAGTTTGCATTCCGGGTCGAAGAAGATTCT
GTTTGGAGCCAAGTTGCTAAGGCGCAACTCAGAGAAGGACTAGTCAGTGATGCAATTGAGTCCTTTATCCGTGCTGATGA
TGCCACTCATTTCTTGGAAGTCATACGTGTCTCTGAAGATACTGATGTCTATGATGACTTGGTCAAATACCTTCTGATGG
TTAGACAGAAGGTGAAGGAACCCAAGGTTGATAGTGAGCTTATCTATGCATATGCAAAGATTGATAGGTTAGGTGAGATT
GAAGAATTCATTCTGATGCCAAACGTTGCTAATCTACAAAATGTTGGTGATCGTCTGTATGACGAAGCTCTGTATGAGGC
TGCAAAAATAATATATGCGTTCATATCAAACTGGGGCAAGTTAGCCGTCACACTTGTGAAGTTGCAACAGTTCCAAGGTG
CTGTTGATGCTGCAAGGAAAGCAAACAGTGCAAAGACATGGAAGGAAGTCTGCTTTGCTTGCGTTGATGCAGAGGAATTC
CGGTTGGCTCAAATCTGTGGTCTTAACATTATCATTCAGGTGGATGACCTGGAAGAAGTCAGCGAGTACTACCAGAACAG
AGGGTGCTTCAATGAATTAATCTCACTTATGGAGAGTGGACTTGGGCTTGAACGTGCTCACATGGGTATCTTCACCGAGT
TGGGTGTACTCTATGCTAGATATCGTTATGAGAAACTTATGGAACACATCAAGTTATTTTCAACTCGCCTCAATATTCCC
AAGCTTATACGGGCCTGTGATGAACAACAGCACTGGCAGGAACTTACCTATCTGTACATTCAATATGATGAGTTTGATAA
TGCTGCGACCACCGTCATGAACCATTCTCCTGAAGCATGGGAGCACATGCAATTCAAAGACATTGTTGCCAAGGTAGCGA
ATGTTGAACTGTACTACAAGGCTGTGCACTTCTACTTGCAAGAGCATCCTGATCTAATCAACGATCTTCTCAACGTGCTT
GCGTTGCGGTTAGACCATACTCGTGTTGTTGATATAATGCGGAAGGCTGGTCACTTACGTCTTATCAAGCCATACATGAT
TGCAGTTCAGAGCAACAATGTCTCTGCCGTTAATGAGGCTCTGAATGAGATATACGTGGAAGAAGAAGACTATGATAGGT
TGCGAGAGTCTATTGATTTACATGACAGCTTTGACCAGATTGGCCTCGCTCAGAAGATCGAGAAACACGAGCTTGTTGAA
ATGAGACGTGTGGCTGCTTATATCTACAAGAAAGCGGGCAGATGGAAGCAATCAATTGCATTATCAAAGAAAGACAACAT
GTACAAGGACTGTATGGAAACTGCTTCACAATCCGGCGAACATGAACTTGCAGAACAACTACTGGTGTACTTCATTGAAC
AGGGGAAAAAGGAATGCTTTGCTACATGTCTGTTTGTATGTTATGACTTAATCCGACCAGACGTGGCTCTTGAACTTGCA
TGGATCAACAATATGATGGACTTTGCCTTCCCGTATCTCCTCCAGTTTATCCGAGAATACTCTGGCAAAGTGGATGAGTT
AATAAAGGACAAGCTGGAGGCACAAAAAGAGGTGAAGGCTAAAGAGCAGGAAGAGAAGGATGTTATGTCCCAACAGAACA
TGTACGCCCAACTATTGCCACTTGCTTTACCTGCACCACCGATGCCAGGAATGGGAGGTGGTGGTGGGTATGGCCCGCCA
CCACAAATGGGCGGTATGCCAGGAATGCCTCCCATGCCACCATATGGAATGCCACCAATGGGTGGCTACTAA