Details for Lyrate rockcress Locus 16056447

Position : sca3 ( 5`- 7308315 .. 7308798 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056447

Protein [Map View]
MGCTKTLVTCFLVIIVATSFSNHKVLASDAGIEGFQIDNCNTRCYGRDECMNYCIRAGFPKGGQCGSLCIPCGFKCCCQK
*

DNA
ATGGGTTGTACGAAAACTTTGGTGACTTGTTTCCTTGTAATAATAGTTGCAACTTCGTTCTCTAACCACAAAGTTTTGGC
TTCAGATGCAGGGATCGAAGGTTTTCAAATTGACAACTGCAATACTAGGTGTTACGGGCGGGATGAATGTATGAACTACT
GTATTAGAGCTGGATTTCCAAAAGGTGGACAGTGTGGGTCTCTTTGTATTCCATGTGGTTTCAAATGTTGTTGCCAAAAG
TAA