Details for Lyrate rockcress Locus 16056407

Position : sca3 ( 5`- 2882958 .. 2880751 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896836 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056407

Protein [Map View]
MDGMSSYHKRNSGLNPCKNSSFSHSSRAMAPGIYRYPEVKSPLRRQVHAPSRILKSGRDRSTRQGSGNVLGTFLTRNDDM
LKRNALDLPLRYRTDREVVDVGDELGDVEMISDDTSREGLGNVAMEVDEVEEKAEMGNGLFSEVVSMKNGSLRVDECSQD
NSSSLVVNRPVTDVTSFEAYRKVLQSAENRTSKLKDRGFGDILKERGCALLRSLFSFSFWKQDKEPVEDVQREAFLTLSR
EEETAVNRAFSANDSNILVAHENSNIEITGKILRCLKPGEWLNDEVINLYLVLLKEREAREPKKFLKCHFFNTFFFTKLF
NSGTGYNYSAVRRWTSMKRLGYHLKDCDKIFIPIHMNIHWTLAVINIKDRKFQYLDSFKGREPKILDALARYFVDEVRDK
SEVDLDVSRWGQEFVQDLPMQRNGFDCGMFMVKYIDFYSRGLDLCFTQEQMPYFRDRTAKEILQLKAE*

DNA
ATGGATGGCATGAGCAGTTACCACAAACGCAATTCCGGTTTAAACCCTTGTAAAAACTCCAGTTTCTCACATTCATCAAG
AGCCATGGCTCCAGGAATTTACCGTTACCCAGAAGTGAAGTCTCCATTGCGGAGACAAGTTCATGCGCCTTCGCGGATCC
TCAAGAGCGGTCGAGATCGTAGCACACGACAAGGTTCTGGTAATGTGTTGGGAACTTTTCTCACAAGGAACGATGATATG
TTGAAAAGAAATGCACTTGATTTGCCTTTGCGCTATAGAACGGATAGAGAAGTGGTTGATGTTGGTGATGAGCTTGGAGA
TGTGGAAATGATATCTGATGATACAAGTAGGGAGGGTCTCGGAAACGTGGCTATGGAGGTGGACGAGGTGGAAGAGAAGG
CAGAGATGGGAAATGGATTGTTTTCTGAGGTTGTTAGTATGAAAAATGGGAGCTTAAGGGTGGATGAATGTTCTCAAGAT
AATAGTAGTTCACTCGTTGTGAATCGCCCTGTGACCGATGTCACGAGTTTTGAAGCATACAGAAAGGTTCTCCAGAGTGC
TGAGAACCGGACTTCGAAACTGAAAGACAGAGGCTTTGGTGATATTTTGAAAGAAAGAGGTTGTGCTTTACTGCGAAGCC
TGTTTTCTTTTTCTTTTTGGAAACAAGATAAAGAACCAGTAGAGGATGTACAACGTGAGGCATTTCTAACTCTTTCTAGA
GAGGAGGAGACAGCAGTCAACCGTGCATTCTCCGCTAATGACTCGAACATCTTGGTTGCACATGAGAATTCAAATATTGA
AATTACAGGGAAAATCCTAAGGTGCCTTAAACCAGGTGAATGGTTGAACGATGAGGTCATTAATCTTTATCTGGTATTGC
TGAAAGAAAGGGAAGCTAGAGAACCAAAGAAGTTTCTTAAATGTCATTTTTTCAATACATTTTTCTTCACTAAGTTATTT
AATTCGGGGACTGGATACAACTACAGCGCAGTCAGAAGATGGACATCAATGAAGAGGTTGGGCTATCATCTCAAAGACTG
TGACAAGATATTTATTCCTATCCATATGAACATCCACTGGACTTTGGCTGTAATTAATATAAAGGACCGGAAATTCCAGT
ATCTTGACTCTTTCAAAGGAAGGGAGCCTAAAATTCTCGATGCACTGGCTAGATACTTTGTCGATGAAGTGAGGGACAAG
AGTGAAGTAGACCTTGATGTAAGTCGATGGGGACAAGAATTTGTCCAGGACCTTCCGATGCAGAGAAATGGATTCGATTG
TGGAATGTTTATGGTGAAATACATCGACTTCTACAGCAGAGGTTTGGATCTTTGTTTCACTCAGGAACAAATGCCATATT
TCCGGGATAGGACAGCGAAGGAGATTCTGCAACTGAAAGCCGAGTGA