Details for Lyrate rockcress Locus 16056405

Position : sca3 ( 5`- 9021399 .. 9026463 -3` )
Annotation : [B2G] POLGAMMA1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056405

Protein [Map View]
MGVSLRHLSPSSFWVSRRPRVSSSILSFLVPRRRILCTRRIAITKGNAGYSTATDCGGSHGFQHSGGHQRSSSVHFSGEW
KLNLGSNTARMVPPTVKQAGAVSAWREEVNDKLRGRNGEHANNQDDAFGNYFRGFVPKLDDVQSYGNGQNFDYNLKPGTD
ITTLGRELNGFMQTNSVRGPVIALPSKDIEVGGKTDVTLKGDEDAHGKRKPLNSDTSLDSASYKEIATISISNVEKCTNL
SKVRANLKKIYNRVLVVDNVSSAKETVAMLMNQYRNLVHACDTEVSRIDVKTETPVDHGEMICFSIYCGSEADFGDGKSC
IWVDVLGENGRDILAEFKPFFEDSSIKKVWHNYSFDNHIIRNYGIKLSGFHGDTMHMARLWDSSRRISGGYSLEALTSDP
RVLGGTETKEEAELFGKISMKKIFGKGKLKKDGSEGKLVIIPPVKELQMEDREAWISYSALDSISTLKLYESMKKQLQAK
KWFLDGNLISKQNMFDFYQEYWQPFGELLAKMESEGMLVDRDYLAQIEIVAKAEQEIAVSRFRSWASKHCPDAKHMNVGS
DTQLRQLFFGGISNSCNDEDLPYEKLFKVPNVDKVIEKGKKRATKFRNIKLHRISDRPLPTEKFTASGWPSISGDTLKAL
AGKVSAEYDYTEGVSDTCLEENIGDDDCISLPDEVLETQHSNTTVESDTSAYGTAFDAFGGGESGKEACHAIAALCEVCS
IDSLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALEKDRYKIRQAFIASPGNSLIVADYGQLELR
ILAHLASCKSMKEAFIAGGDFHSRTAMNMYPHIREAVENGEVLLEWHPQPGQEKPPVPLLKDAFASERRKAKMLNFSIAY
GKTAIGLSRDWKVSIEEAQDTVNLWYNDRQEVRKWQELRKKEAIQNGYVLTLLGRARKFPVYRSRAQKNHIERAAINTPV
QGSAADVAMCAMLEISKNQRLKELGWKLLLQIHDEVILEGPSESAENAKDIVVNCMSEPFNGKNILSVDLSVDAKCAQNW
YAGK*

DNA
ATGGGGGTTTCTCTTCGCCACTTGTCTCCTTCCTCTTTCTGGGTTTCGCGTCGTCCTCGCGTTTCTTCTTCAATTCTTTC
TTTTCTTGTGCCTCGCCGTCGAATCCTTTGCACCAGGAGAATAGCCATCACAAAGGGAAATGCCGGATATTCCACTGCTA
CTGATTGTGGTGGTTCCCATGGGTTTCAGCATTCAGGTGGTCATCAACGGTCATCCTCTGTTCATTTTAGTGGAGAGTGG
AAGCTTAATTTGGGATCTAACACGGCGAGAATGGTACCACCAACTGTGAAACAAGCTGGAGCTGTAAGTGCTTGGAGGGA
GGAAGTCAATGATAAGTTAAGAGGAAGAAATGGCGAACATGCTAACAACCAGGATGATGCTTTTGGTAATTATTTCAGAG
GCTTTGTCCCCAAATTAGATGATGTCCAATCCTATGGAAACGGCCAGAACTTTGATTACAATCTGAAGCCTGGAACTGAT
ATTACCACACTTGGTAGAGAATTGAATGGCTTTATGCAAACGAATAGTGTTAGAGGGCCGGTTATAGCATTACCAAGCAA
GGATATTGAGGTTGGGGGGAAAACAGACGTGACTCTGAAAGGAGACGAGGATGCACATGGAAAACGAAAACCTCTTAACA
GTGATACGTCTCTTGACAGTGCAAGCTATAAGGAAATAGCAACCATTTCCATTTCCAATGTGGAAAAATGCACCAACCTG
TCGAAAGTCCGAGCAAACCTCAAGAAAATATATAATAGGGTTCTTGTTGTTGATAATGTGTCTAGTGCAAAGGAAACCGT
GGCTATGCTGATGAATCAATATAGGAATCTTGTCCATGCTTGCGATACAGAGGTGTCCAGGATTGATGTGAAGACTGAAA
CACCTGTGGACCATGGGGAGATGATATGTTTCAGTATCTATTGTGGATCAGAAGCAGATTTTGGAGACGGAAAATCATGT
ATCTGGGTAGATGTGCTTGGCGAAAATGGAAGGGATATCTTGGCTGAGTTTAAGCCATTTTTCGAGGACTCATCCATAAA
AAAAGTATGGCATAACTACAGCTTTGATAACCACATCATCAGAAATTATGGAATCAAGCTTTCTGGTTTTCATGGTGATA
CGATGCACATGGCACGATTGTGGGATTCATCTAGACGGATATCGGGTGGTTATTCGCTCGAAGCACTTACAAGTGACCCA
AGAGTTCTTGGGGGAACTGAGACAAAGGAGGAAGCAGAATTATTTGGTAAAATATCAATGAAGAAAATTTTCGGTAAGGG
AAAATTGAAAAAAGATGGATCAGAAGGGAAATTGGTGATCATTCCTCCTGTTAAAGAGCTACAAATGGAGGATCGAGAAG
CTTGGATTTCCTACTCGGCGTTGGATTCGATAAGCACTCTAAAGCTTTATGAGAGCATGAAGAAGCAATTGCAAGCGAAG
AAATGGTTTCTTGATGGAAATCTAATTTCAAAACAGAACATGTTTGATTTCTACCAAGAATATTGGCAACCTTTTGGTGA
ACTTCTTGCCAAAATGGAATCGGAAGGAATGCTTGTAGATAGGGATTATTTGGCGCAGATTGAGATTGTAGCCAAAGCAG
AACAAGAAATTGCTGTTTCCAGGTTCCGTAGTTGGGCTTCAAAGCATTGTCCAGATGCGAAGCATATGAATGTTGGCAGT
GACACGCAATTGCGACAGCTCTTTTTTGGTGGCATTTCTAACAGTTGTAATGATGAGGATCTTCCATATGAAAAACTTTT
CAAAGTTCCCAATGTGGATAAGGTGATTGAAAAAGGAAAAAAGAGAGCCACAAAGTTCCGGAATATCAAACTACATAGGA
TTAGCGACAGGCCCTTGCCCACTGAAAAGTTCACTGCCTCAGGCTGGCCCTCTATTAGTGGAGACACCTTGAAAGCCTTA
GCTGGGAAAGTCTCTGCAGAATATGACTATACAGAGGGCGTTTCAGATACTTGTCTAGAAGAAAACATTGGAGATGATGA
TTGTATTTCGCTACCAGATGAAGTTTTAGAAACACAACACTCCAATACCACTGTTGAATCAGACACATCTGCTTATGGAA
CTGCGTTTGATGCGTTTGGAGGGGGTGAAAGTGGAAAGGAGGCCTGCCATGCTATTGCTGCATTATGTGAAGTTTGCTCC
ATTGATTCCTTAATATCAAATTTTATTCTTCCTTTACAGGGAAGTAATGTGTCAGGAAAAGATGGTCGTGTCCACTGCTC
CCTGAATATTAACACTGAAACTGGGCGCTTATCGGCTAGAAGGCCAAATTTGCAGAACCAACCTGCATTGGAGAAAGATC
GGTACAAGATCCGTCAGGCCTTCATAGCATCACCTGGAAATTCACTTATTGTTGCTGATTATGGACAGCTGGAACTTAGG
ATTCTGGCACATCTTGCTAGTTGCAAAAGCATGAAGGAAGCTTTCATAGCTGGTGGAGACTTTCACTCAAGAACAGCTAT
GAATATGTATCCACATATTCGTGAAGCAGTTGAAAATGGTGAAGTGCTCCTTGAATGGCATCCACAACCTGGACAAGAGA
AGCCACCAGTGCCATTGTTGAAGGATGCCTTTGCTTCTGAGAGAAGAAAAGCAAAGATGCTTAACTTCTCGATTGCATAT
GGGAAGACTGCTATTGGGCTGTCTAGAGATTGGAAGGTATCAATAGAAGAAGCTCAAGATACAGTTAATCTCTGGTATAA
TGACAGACAAGAAGTCCGGAAATGGCAAGAACTACGCAAGAAAGAAGCTATACAAAATGGGTATGTACTCACTTTGTTGG
GAAGGGCTCGTAAATTCCCTGTATACCGTTCACGTGCCCAAAAAAACCATATCGAACGAGCAGCAATCAACACTCCTGTT
CAGGGAAGTGCGGCTGATGTTGCTATGTGCGCTATGCTGGAGATATCAAAAAATCAACGTCTAAAAGAGCTTGGTTGGAA
ATTGCTTCTTCAAATTCATGATGAAGTAATCTTGGAAGGACCAAGTGAGTCAGCGGAGAACGCTAAAGACATAGTTGTGA
ACTGCATGTCTGAGCCCTTCAACGGCAAGAATATTCTCTCAGTGGACTTATCTGTTGATGCTAAGTGTGCTCAGAACTGG
TATGCTGGAAAATAA