Details for Lyrate rockcress Locus 16056403

Position : sca3 ( 5`- 5457900 .. 5458404 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056403

Protein [Map View]
MNWKLVLLFGWILLSSIASNPTLAKVTYPPRTTRKGLGNIHINKGMKIGFTGSFSRPAPHGGGPPKIISKL*

DNA
ATGAACTGGAAGTTGGTTTTGCTATTTGGTTGGATTCTCCTCTCGTCTATTGCATCAAACCCAACTTTGGCTAAAGTAAC
ATATCCACCTCGCACGACAAGAAAAGGGCTTGGAAATATACACATCAACAAAGGAATGAAGATTGGCTTTACAGGCAGTT
TTTCTAGACCTGCTCCTCACGGAGGCGGTCCACCGAAGATCATTTCTAAGTTGTGA