Details for Lyrate rockcress Locus 16056377

Position : sca1 ( 5`- 7707700 .. 7708705 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472055 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056377

Protein [Map View]
MALVRERRRINLRLPLPPLYDRLPCFSFASSTAAVTSKLDVINNGISASDIEKLHVLGSGTGGIVYKVHHKTTGELYALK
TVNGDMSSTFTRQLTREMEILRRTESPYIVRCHGIFEKPIAGEVSILMEYMDGGNLESLRGAVTEKQLAGFSRQILKGLT
RRDLTPSVAGENSDVYAGDIWSFGLMMLELFVGHFPLLPQGQRPDWATLMCAVCFGEPPRTPEGCSDEFRSFVDCCLRKE
SSERWTASQLLGHSFLREVPIACDVTGLDLFSG*

DNA
ATGGCTCTTGTTCGTGAACGCCGTCGAATCAACCTCCGTCTCCCTCTTCCACCACTCTACGATCGCCTCCCCTGTTTCTC
CTTTGCCTCCTCAACCGCCGCCGTCACATCCAAATTGGATGTCATCAACAATGGAATCTCCGCTTCCGATATCGAGAAAC
TCCACGTTCTCGGAAGCGGAACCGGCGGGATCGTATACAAAGTCCACCACAAAACCACGGGGGAGCTATACGCTCTGAAA
ACAGTCAACGGAGACATGAGTTCTACTTTCACAAGACAATTAACACGCGAGATGGAGATCCTCCGTCGCACGGAATCTCC
TTATATCGTCCGGTGTCACGGGATCTTCGAGAAACCAATCGCCGGCGAGGTTTCAATCCTCATGGAGTATATGGACGGCG
GAAACCTAGAATCTCTCCGCGGCGCCGTAACAGAGAAACAACTCGCTGGATTTTCCCGCCAGATTTTGAAAGGATTAACC
CGGAGAGATTTGACTCCGTCCGTCGCCGGAGAAAACTCCGATGTATACGCAGGCGATATCTGGAGTTTCGGATTGATGAT
GCTCGAGCTCTTCGTCGGACATTTTCCGTTGCTTCCTCAGGGACAGAGACCTGATTGGGCGACGCTAATGTGCGCCGTGT
GTTTCGGAGAGCCACCGCGTACGCCGGAAGGATGTTCCGACGAGTTTAGGAGTTTTGTTGATTGTTGTCTCCGTAAAGAA
TCGAGTGAGAGGTGGACGGCGTCGCAGCTTCTCGGTCACTCTTTTCTCCGTGAAGTTCCGATTGCTTGTGATGTTACGGG
TCTGGATCTTTTTTCCGGGTGA