Details for Lyrate rockcress Locus 16056360

Position : sca3 ( 5`- 4982568 .. 4981375 -3` )
Annotation : [B2G] ATELC [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056360

Protein [Map View]
MVPSPSNPQQIQQFLSSALSQRGPSSVPYEESNKWLIRQHLLNLISSYPSLEPKTASFMHNDGRSVNLLQADGTIPMPFH
GVTYNIPVIIWLLESYPRHPPCVYVNPTADMIIKRPHAHVTPSGLVSLPYLQNWVFPSSNLVDLVSDLSAAFARDPPLYS
RRRPQPPPPSPPTGYDSSLTRPPSADQSLARPFPPSPYGGGGRVQVQHVHHQQQSDDAAEVFKRNAINKMVEMVHGDLVS
MRRAREAEAEELLSLQAGLKRREEELNRGLREMVEEKETLEQQLQVISMNTDILDSWVRENQGKTKNLVDLDVDNAFECG
DTLSKQMLECTALDLAIEDAIYSLDKSFQDGVVPFDQYLRNVRLLSREQFFHRATGSKVRAAQMEVQVAAIAGRLHS*

DNA
ATGGTTCCTTCGCCGTCGAATCCGCAGCAGATTCAGCAGTTCCTCTCTTCCGCGCTCTCCCAGCGCGGTCCATCTTCAGT
TCCCTACGAAGAGTCCAACAAGTGGTTGATCCGGCAACATCTACTTAACCTAATCTCTTCTTACCCTTCCTTAGAGCCCA
AAACGGCATCGTTTATGCACAACGATGGCCGCTCCGTCAATCTCCTTCAAGCAGATGGTACGATCCCGATGCCTTTCCAT
GGAGTCACCTATAACATCCCTGTAATCATCTGGCTCCTCGAATCTTATCCTCGCCATCCTCCTTGCGTCTATGTGAATCC
TACCGCCGATATGATCATAAAGCGACCTCACGCACATGTTACTCCTTCTGGTCTCGTTTCTCTTCCTTATCTTCAGAATT
GGGTTTTCCCTAGCTCAAATCTCGTAGATCTTGTCTCCGATCTCAGCGCTGCTTTTGCTCGTGATCCGCCTCTTTATTCA
CGACGCCGTCCTCAGCCGCCGCCACCGTCTCCTCCTACTGGATACGATTCGTCTCTGACACGACCTCCTTCTGCTGATCA
GTCATTAGCTAGACCGTTCCCGCCATCACCTTACGGTGGAGGAGGTAGGGTGCAAGTGCAGCATGTTCACCACCAGCAGC
AATCGGATGATGCTGCGGAGGTTTTCAAGAGAAACGCGATTAATAAGATGGTGGAGATGGTTCACGGCGATTTGGTTTCG
ATGAGGAGAGCCAGAGAAGCTGAAGCAGAGGAGCTACTGAGTTTGCAAGCTGGGCTGAAGAGAAGAGAGGAAGAGCTTAA
TAGAGGTTTGAGAGAGATGGTTGAGGAGAAAGAAACACTTGAACAACAATTACAGGTTATCTCCATGAACACTGATATTC
TAGACTCTTGGGTTAGAGAGAACCAAGGCAAAACCAAGAATTTAGTTGATTTGGATGTGGATAATGCTTTTGAATGTGGT
GACACACTCTCTAAGCAGATGTTAGAGTGTACTGCTTTGGATTTAGCCATTGAAGATGCTATTTATTCCTTGGATAAATC
GTTTCAAGATGGGGTTGTTCCCTTTGATCAGTACTTGAGGAATGTAAGGTTGTTGTCGAGGGAACAGTTCTTCCACCGTG
CCACGGGTTCTAAAGTCAGGGCGGCACAGATGGAGGTTCAGGTTGCAGCGATCGCAGGTAGGTTGCATTCATGA