Details for Lyrate rockcress Locus 16056341

Position : sca3 ( 5`- 5493483 .. 5493665 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056341

Protein [Map View]
MESMNMKLMVVLMVAIVALSAVGNVAAQTEAPAPSPTSDAAMFVPALFASVAALVSGFLF*

DNA
ATGGAGTCAATGAACATGAAGCTCATGGTGGTGTTGATGGTGGCTATTGTGGCTTTATCCGCCGTAGGAAACGTGGCTGC
GCAGACAGAGGCTCCGGCTCCAAGTCCTACTTCCGATGCTGCCATGTTTGTCCCGGCATTGTTTGCATCTGTTGCTGCTT
TGGTATCTGGGTTTCTCTTCTAA