Details for Lyrate rockcress Locus 16056309

Position : sca3 ( 5`- 2535456 .. 2534496 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056309

Protein [Map View]
MEANAAVDGTGNPIPTSAVLTASAKHIGIRCMPENMAFLKCKKNDPNPEKCLEKGRDVTRCVLGLLKDLHQRCPKEMDAY
VGCMYYYTNEFDLCRKEQEVFEKACPLK*

DNA
ATGGAGGCGAATGCGGCGGTGGACGGAACGGGGAATCCGATCCCTACGTCGGCGGTTTTAACAGCTTCGGCGAAGCATAT
AGGAATCAGGTGTATGCCGGAAAACATGGCGTTCCTGAAATGCAAGAAGAATGATCCTAATCCAGAGAAATGCCTCGAGA
AAGGACGTGACGTCACTCGCTGTGTTCTTGGCCTGCTCAAGGATCTTCACCAGAGATGCCCCAAGGAGATGGATGCTTAC
GTTGGATGCATGTATTACTACACCAACGAGTTTGATTTGTGTCGGAAAGAGCAAGAAGTCTTCGAGAAAGCGTGCCCGTT
GAAATGA