Details for Lyrate rockcress Locus 16056308

Position : sca3 ( 5`- 7881735 .. 7885718 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056308

Protein [Map View]
MGRRIKRKGLINTEAVREFINHLVAERHSLLVLVPLVLAFWAIERWVFAFSNWVPLVVAVWASLQYGSYQRAILAEDLTK
KWRQTVFNASTITPLEHCQWLNKLLSEIWLNYMNKKLSLRFSSMVEKRLRQRRSRLIENIQLLEFSLGSCPPLLGLHGTC
WSKSGEQKIMRLDFNWDTMDLSILLQAKLSKPFNRTARIVVNSLCIKGDILIRPILEGKALLYSFVSNPEVRIGVAFGGG
GGQSLPATELPGVSSWLVKILTETLNKKMVEPRRGCFSLPATDLHKTAIGGIIYVIVVSGNNLNRRILRGSPSRSSEIGD
GSSGNSSSKPVQTFVEVELEQLSRRTEMKSGPNPAYQSTFNMILHDNTGTLKFNLYENNPGSVRYDSLASCEVKLKYVGD
DSTMFWAVGSDNSVIAKHAEFCGQEIEMVVPFEGVSSGELTVRLLLKEWHFSDGSHSLNSVNSSSLHSLDSSSTLLSKTG
RKIIVTVLAGKNLVSKDKSGKCDASVKLQYGKIIQKTKIVNAAESAWNQKFEFEELTGEEYLKVKCYREEMLGTDNIGTA
TLSLQGINNSEMHIWVPLEEVNSGEIELLIEAMDPEYSKADSSKGMIELVLVEARDLVAADLRGTSDPYVRVQYGEKKQR
TKVIYKTLQPKWNQTMEFPDDGSSLELHVKDHNTLLPTSSIGNCVVEYQGLKPNETADKWIPLQGVTCGEVHVRVTRKVT
EIQRRASAGSGSPFNKARLLSNQMKQVMIKFQNLIDDGDLEGLSEALEELESLEVEQEEYLVQLQTEQMLLINKIKDLGK
EILNSSPVQAPSHSPSR*

DNA
ATGGGTCGGAGAATAAAGAGGAAAGGTCTGATAAACACGGAAGCTGTGAGAGAATTTATCAATCATCTAGTTGCTGAGAG
ACATTCGTTATTGGTGCTGGTTCCTTTGGTCTTAGCTTTCTGGGCAATTGAGAGATGGGTCTTTGCTTTCTCCAATTGGG
TTCCTCTCGTTGTCGCCGTTTGGGCTTCTCTTCAGTATGGAAGTTACCAAAGGGCAATACTTGCTGAAGATCTAACCAAG
AAGTGGAGGCAAACCGTTTTCAATGCGTCGACGATAACTCCATTGGAACATTGTCAATGGCTGAACAAGTTACTGTCTGA
AATTTGGTTAAACTATATGAACAAGAAACTCTCTCTCAGATTTTCTTCTATGGTGGAGAAACGATTGAGGCAACGAAGAT
CAAGATTAATAGAAAATATACAATTGTTGGAGTTTTCTCTTGGCTCGTGCCCTCCTTTGCTGGGACTCCATGGAACTTGT
TGGTCAAAATCAGGGGAACAGAAAATTATGCGATTGGATTTCAATTGGGACACAATGGATCTAAGTATTTTGTTGCAAGC
CAAGTTATCCAAACCGTTTAATCGAACAGCACGAATCGTTGTCAATAGTCTCTGCATCAAGGGCGATATTCTGATCAGAC
CAATTCTTGAAGGAAAAGCATTGCTTTATTCCTTTGTATCGAATCCTGAAGTTAGAATCGGAGTTGCTTTCGGTGGTGGC
GGTGGCCAATCTCTCCCCGCGACAGAGCTCCCCGGTGTCTCCTCTTGGCTGGTAAAGATTCTAACGGAAACTTTGAACAA
GAAGATGGTAGAGCCACGCCGGGGATGTTTCTCGTTACCCGCAACCGATCTTCACAAAACAGCCATCGGGGGAATCATCT
ACGTAATCGTTGTCTCTGGTAACAATCTTAACCGCAGGATTCTTCGGGGAAGCCCGTCAAGAAGTTCTGAAATTGGAGAC
GGTAGCAGCGGAAATAGCAGCAGCAAACCTGTTCAGACATTTGTCGAGGTCGAACTCGAACAACTTTCTCGACGAACCGA
GATGAAGTCAGGACCGAATCCAGCTTATCAATCGACATTTAACATGATCTTACACGACAATACAGGGACACTCAAGTTTA
ACCTCTATGAAAATAATCCTGGGAGTGTCAGATACGACAGTCTCGCTAGCTGCGAAGTTAAGCTGAAATACGTTGGTGAT
GATTCAACGATGTTTTGGGCCGTTGGATCTGATAACAGTGTGATTGCGAAACACGCTGAGTTCTGTGGTCAAGAAATCGA
GATGGTTGTTCCGTTTGAAGGAGTTAGCTCCGGCGAGTTGACGGTCAGGCTACTTCTAAAAGAATGGCATTTCTCTGATG
GCTCACATAGCTTGAATAGCGTTAATTCGAGTTCATTACACTCCCTCGACAGCTCGTCTACCCTCCTCTCGAAAACCGGC
CGGAAAATTATTGTGACGGTTTTGGCTGGAAAGAACCTTGTATCTAAAGATAAGTCCGGAAAATGTGATGCCTCTGTCAA
GTTACAGTACGGAAAAATTATACAAAAGACGAAGATAGTGAACGCAGCGGAGAGTGCCTGGAACCAGAAATTTGAGTTCG
AAGAGTTAACCGGGGAAGAATATTTAAAGGTGAAATGCTATAGGGAAGAGATGCTTGGCACGGACAACATCGGTACAGCT
ACATTGAGTCTTCAAGGAATCAATAACAGCGAAATGCATATATGGGTTCCGCTTGAAGAGGTTAATTCTGGAGAAATAGA
GCTTTTGATCGAGGCTATGGATCCCGAGTACAGCAAAGCGGATTCAAGTAAAGGCATGATTGAATTGGTTCTCGTTGAAG
CACGGGATCTTGTGGCCGCGGATCTTAGAGGAACCAGTGATCCTTATGTTAGGGTTCAATATGGAGAGAAGAAACAGAGG
ACAAAGGTGATTTATAAGACATTGCAACCAAAATGGAACCAGACAATGGAGTTTCCAGATGATGGGAGCTCCTTGGAGCT
ACATGTGAAAGACCATAACACTCTGCTTCCTACTTCAAGCATCGGTAACTGCGTCGTGGAGTACCAAGGGTTAAAGCCAA
ATGAGACTGCTGATAAGTGGATACCTCTCCAAGGAGTGACATGCGGCGAGGTCCATGTCAGAGTCACGAGGAAAGTCACA
GAGATTCAGAGACGCGCCAGCGCGGGGTCTGGTTCCCCGTTTAACAAAGCTCGGTTGCTGTCCAACCAGATGAAGCAGGT
GATGATAAAGTTTCAGAATTTGATTGACGATGGAGATCTTGAAGGTCTTTCTGAAGCTTTAGAAGAGCTGGAGAGTTTGG
AGGTCGAACAAGAAGAGTATTTGGTCCAGCTTCAGACAGAGCAAATGCTGCTTATCAACAAGATCAAAGACCTTGGTAAG
GAGATTCTTAACTCGTCCCCAGTTCAAGCCCCATCTCATTCCCCATCTCGATAG