Details for Lyrate rockcress Locus 16056305

Position : sca3 ( 5`- 5446413 .. 5444522 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056305

Protein [Map View]
MMKIQISAVALLVALSMASLFEIGLASTNTVPAFLWSPHLQSANGELDEVVNYQVMSAKDLVGSVFTQGGWSNFLCSEKK
LEQPVDVALVFIGRELLSSDVSSKRNSDSALVNTLSNLFTASNFSLAFPYIAAPEEERMENLLLSGLKEACPNNVGVSNI
VFSDSCFVQDGTIQKLSDLQSFKDHLLARRETRKEGETDLVVLCSEGSESKSQAAQSHSERESILELVSSVEQSGSKYTA
LYVSDPYWYTSYKTLQRFLAETAKGNSTPEVATACDELCKFKSSLLEGILVGIVFLLILISGLCCMAGIDTPTRFETPQD
S*

DNA
ATGATGAAGATTCAAATTAGTGCGGTGGCGTTATTGGTGGCTCTATCTATGGCCTCTCTCTTTGAAATTGGATTGGCTTC
TACAAACACCGTTCCTGCTTTCCTCTGGTCTCCGCATCTCCAGTCTGCTAATGGTGAATTGGATGAGGTTGTAAATTATC
AGGTCATGTCTGCAAAGGATCTAGTAGGTTCTGTTTTCACTCAAGGAGGTTGGTCAAACTTTCTGTGCTCAGAGAAGAAG
CTTGAGCAACCTGTTGATGTTGCACTTGTGTTCATAGGAAGAGAGTTACTGTCTTCTGATGTTTCTTCTAAAAGGAACTC
GGATTCTGCCCTTGTTAACACATTGAGTAATCTGTTTACAGCTTCCAACTTCTCATTGGCATTCCCATATATTGCTGCGC
CAGAGGAAGAAAGGATGGAGAATTTGTTGCTATCAGGACTTAAAGAAGCTTGCCCCAACAATGTTGGAGTCAGCAATATC
GTGTTCTCAGATTCGTGCTTTGTTCAGGATGGAACAATTCAGAAACTATCAGACTTGCAGTCTTTCAAAGATCATTTGCT
TGCTAGAAGAGAAACAAGGAAAGAAGGAGAAACTGACTTGGTTGTGCTCTGTTCCGAGGGTTCTGAATCAAAAAGTCAAG
CTGCTCAATCTCATTCAGAGCGTGAAAGCATCTTGGAACTTGTTAGTTCTGTAGAACAATCCGGCAGTAAATATACAGCT
CTTTATGTTTCTGATCCTTATTGGTACACATCTTACAAAACTCTCCAAAGGTTTCTAGCTGAAACTGCTAAAGGAAACAG
CACTCCTGAAGTTGCAACTGCCTGTGATGAACTCTGCAAATTTAAGTCATCACTCTTGGAGGGCATACTAGTGGGAATCG
TTTTTCTTCTCATCTTGATCAGTGGACTTTGCTGTATGGCGGGTATCGATACACCGACTAGATTCGAGACTCCTCAAGAT
TCTTAA