Details for Lyrate rockcress Locus 16056299

Position : sca3 ( 5`- 2612102 .. 2611854 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896767 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056299

Protein [Map View]
MKDLVFLINKEKGASSSAMVSNELGRNCPDFVTAFDGDLSGLRHVLLELPCGLIEDSSVTLVGIPDEHSRSFQIQLVGSE
QL*

DNA
ATGAAAGATTTGGTTTTTCTGATCAATAAAGAGAAAGGAGCTTCTTCTTCTGCTATGGTCTCTAACGAACTTGGAAGGAA
CTGTCCGGATTTTGTCACTGCATTTGATGGAGATTTGTCTGGTTTAAGGCATGTACTACTTGAGCTTCCTTGTGGTTTAA
TTGAAGATTCTTCAGTAACTTTGGTTGGTATTCCTGATGAACATTCTAGAAGCTTTCAGATTCAGCTCGTTGGCTCGGAA
CAATTATGA