Details for Lyrate rockcress Locus 16056291

Position : sca3 ( 5`- 4506855 .. 4504263 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478464 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056291

Protein [Map View]
MSTRKAKTKNEASSSRGGVGGESVVADCGRNKSTCGYCKSSTRSSISHGLWTERLTVNDYQALLDRGWRRSGCFLYKPEM
DKTCCPSYTIRLKASDFVPSKEQQRVRRRLERFLDGEIDAKPSEQTEYQDVSFSREVSGSVRKSLGAAKREQNNEVEPIM
KDLAEQIDNAVQRCIQSGEFPSNIQIPKASVKRVLSAKRKKLAEGSEELLYTSNIAFPIVAAIKRTETSEKGKNVEENRL
SPEAVSEKLLIAMNKVEEFTGFSVKVSKGHINFLSATGVTSSDRNEGEESLCATTTKSSSNKLRARKRKLEMHLKRSSFD
PEEYELYKRYQLKVHNDKPESISETSYKRFLVDTPLIEVPPSGYDDEEKLPPCGFGSFHQQYRVDDRLIAVGVIDILPNC
LSSKYLFWDPDFASLSLGNYSALQEIDWVKQNQAHCATLEYYYLGYYIHSCNKMRYKAAYRPSQLLCPLRYQWVPFEVAK
PLLDKKPYSVLSNFTKDSLSSSSPKAYETIVQSTREHEDMEQGETNDDDGDEMYNSDEDSDSSRNRNDIANILISLDGPR
LRYKDIPRIKNPVVQKQLESMLINYRKVVGTELLERMVYELR*

DNA
ATGTCGACGAGGAAAGCGAAGACGAAGAACGAGGCAAGTAGTAGCCGTGGTGGCGTCGGCGGAGAGAGTGTAGTCGCTGA
TTGTGGACGAAATAAATCCACTTGCGGTTACTGTAAATCTTCTACCCGCTCCAGTATCTCTCACGGTTTATGGACAGAGA
GACTCACCGTTAATGACTACCAAGCTCTTCTTGACCGTGGATGGAGACGATCTGGCTGCTTCCTTTACAAACCTGAGATG
GATAAAACTTGTTGCCCTTCTTATACAATCCGCTTGAAAGCAAGCGATTTTGTTCCTTCTAAGGAACAGCAGCGAGTGCG
TAGAAGACTAGAAAGGTTCTTGGATGGCGAAATAGATGCGAAGCCGAGTGAGCAGACAGAATATCAAGACGTTTCTTTCT
CCCGCGAAGTTTCAGGGTCAGTGAGAAAATCACTTGGAGCTGCTAAAAGAGAACAAAACAATGAAGTGGAACCAATCATG
AAAGATTTGGCTGAACAAATTGATAATGCGGTACAAAGATGCATACAAAGTGGTGAGTTTCCTTCTAATATTCAGATTCC
CAAAGCTTCAGTAAAGAGAGTTCTCTCTGCTAAAAGGAAGAAACTAGCTGAAGGGTCAGAAGAACTCTTATACACCAGCA
ACATTGCTTTCCCAATAGTAGCTGCAATAAAACGCACAGAGACATCTGAGAAAGGCAAAAACGTAGAAGAAAACAGATTA
TCACCAGAGGCTGTTTCTGAGAAGTTGTTAATTGCAATGAATAAGGTAGAAGAGTTTACTGGTTTTTCTGTTAAGGTCTC
CAAGGGCCATATCAACTTCCTTTCAGCTACCGGAGTTACTTCCTCAGATAGAAATGAAGGTGAAGAAAGCCTCTGTGCTA
CAACAACAAAGTCTTCTTCGAACAAGCTTCGTGCAAGAAAGCGGAAGCTTGAGATGCACTTGAAAAGGTCGAGTTTTGAT
CCAGAGGAATATGAATTATACAAACGGTATCAACTCAAAGTGCATAATGATAAGCCGGAGAGCATCTCAGAAACTTCATA
CAAAAGGTTTTTGGTTGACACTCCGCTCATTGAAGTTCCGCCTTCAGGTTATGATGACGAAGAAAAGCTTCCTCCTTGTG
GCTTTGGTTCTTTCCATCAACAATACCGAGTTGATGACCGTCTAATTGCTGTGGGGGTGATTGACATTCTTCCTAATTGT
TTGTCGAGTAAATATCTATTCTGGGATCCGGATTTCGCATCCTTGTCTCTTGGAAACTACTCAGCCCTGCAAGAAATCGA
TTGGGTAAAACAGAACCAAGCTCATTGTGCTACTCTTGAGTATTACTATCTTGGTTATTACATACATTCCTGCAACAAGA
TGAGATATAAAGCAGCCTATCGTCCGTCTCAGCTTCTATGCCCTCTCCGGTACCAATGGGTTCCATTTGAAGTAGCCAAG
CCTCTGCTTGATAAAAAGCCATATTCCGTCTTGTCCAATTTCACTAAGGATTCTCTATCATCATCATCACCTAAAGCTTA
TGAAACCATAGTGCAATCCACGAGGGAACATGAAGACATGGAACAAGGGGAAACAAATGATGACGATGGTGATGAAATGT
ATAACTCTGATGAAGACTCAGACTCTAGCAGAAACCGGAATGACATTGCCAATATCCTTATCAGTCTTGATGGACCTCGA
CTTCGATACAAGGATATACCACGGATCAAGAATCCAGTGGTTCAGAAACAACTGGAATCGATGTTGATTAATTACAGGAA
AGTTGTCGGAACTGAGCTATTGGAGAGAATGGTGTATGAACTCCGGTAA