Details for Lyrate rockcress Locus 16056290

Position : sca3 ( 5`- 8352381 .. 8354910 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056290

Protein [Map View]
MCCRRHLTESMETNQWRSKKKIESAAETLQASSRRSRVQARMVAPVNGVRPDRARKSLSEKLDTVAFNSPKKDARVNLYG
DKSVVDEIFLEDEEMGLETGLGNRESSPFCGVSDRLLQRIELLGRDHEAKRLDNNNIRSTETMKKRQEESSGDDLIEMKT
KFQTLAVENSQLKKSLVAKEELAVSLQERKFQVESEFEALMTRLDSTEKENAFLRYEYNVLEKDLEVKTEETEHTRRSME
LTHKQQLRNVNKIVELEAECQRLRLLFRKKFPEKSISMRNEGEEKKMEMRRRNANKSDLMMRDEVQSRKLKYDLLMEQIG
NVRAENKNLMDIIMKKNMEIKDLSRGQKPLEASSFDIRSESSVISPCGSKEMKLLMDDFNEMEKLAIVCTEKDPRVDDEK
EGSFDWIQVVLSAITKQERISKRGVKELLQDIKIALGCMDENDNAARKKGEEDPLCITWKSPSESGPMTKDEIKRHLGLT
KADKVEKIECDEKQELRNKLEESEEKIRNLEAEIKTLRESKEAVEAEMETEKSMKGDLDTNLNIIRAKLNETQKKLSSLE
VELDYRKSCCEELEGTCIELQLQLESVETKKPTQRNKNGWDIATASVKLSECQETITNLRKQLRALSTTETSSTMKFLHK
RSSLRENIEDSTAKDSSYKAEDDNNRVSHDDDGNHYNALIVYEPVKARGEKMEMVQRKKQGLGFLKKLLFRRKRVSSKKC
LALTM*

DNA
ATGTGTTGCAGAAGACATCTTACAGAATCAATGGAAACAAATCAGTGGCGGTCGAAGAAAAAGATAGAATCTGCAGCAGA
AACACTCCAAGCTTCTTCTAGAAGAAGCAGAGTACAGGCACGTATGGTTGCTCCAGTAAATGGAGTTAGACCCGATAGAG
CTCGAAAAAGTCTAAGTGAGAAGCTAGACACTGTAGCCTTTAACTCTCCTAAGAAAGATGCTCGTGTGAATCTTTATGGC
GACAAAAGTGTAGTAGATGAGATTTTCCTTGAAGATGAAGAAATGGGTCTTGAAACTGGTTTGGGGAATAGAGAGTCATC
GCCTTTTTGTGGTGTATCCGACAGGCTTCTGCAGCGAATCGAGCTTCTTGGGAGAGATCATGAGGCAAAGAGACTTGATA
ACAACAATATCAGGTCAACTGAAACTATGAAAAAGAGACAAGAAGAATCTTCAGGTGATGATCTAATTGAGATGAAGACA
AAGTTTCAAACTTTAGCTGTGGAGAACTCTCAGCTTAAGAAGTCTCTTGTGGCGAAAGAAGAGCTTGCGGTAAGCCTACA
AGAGCGTAAATTTCAGGTGGAATCAGAATTTGAAGCGTTGATGACTAGATTAGATTCAACGGAGAAAGAAAACGCATTCT
TGAGATATGAGTATAATGTTCTTGAGAAGGATCTTGAGGTAAAAACAGAGGAAACAGAGCATACTCGTAGGTCTATGGAG
CTAACGCATAAACAGCAACTTAGGAATGTGAACAAGATTGTTGAGCTTGAAGCTGAATGCCAAAGGTTAAGACTTCTGTT
TCGGAAGAAGTTTCCGGAGAAGTCTATATCGATGAGGAATGAAGGTGAAGAAAAGAAGATGGAGATGAGAAGAAGAAACG
CGAACAAGAGCGATTTGATGATGAGAGATGAAGTTCAAAGCCGGAAGCTTAAGTATGATCTGTTGATGGAGCAGATTGGG
AATGTTAGGGCAGAGAACAAGAATCTAATGGACATAATTATGAAGAAAAACATGGAGATCAAAGATCTTAGCCGCGGGCA
GAAACCGTTAGAGGCTTCGAGTTTCGACATTAGAAGCGAAAGTAGTGTGATTAGCCCTTGTGGTTCGAAGGAGATGAAAC
TACTGATGGATGATTTTAATGAGATGGAGAAGTTAGCCATTGTGTGTACTGAGAAGGATCCAAGAGTGGATGATGAAAAG
GAAGGATCTTTTGATTGGATTCAAGTTGTTTTGAGCGCTATAACGAAGCAAGAGAGGATATCGAAACGCGGTGTTAAAGA
ACTCTTACAAGACATCAAGATTGCTTTAGGATGTATGGATGAAAATGATAATGCAGCAAGAAAGAAAGGTGAAGAAGATC
CTCTCTGCATCACATGGAAATCTCCTAGTGAATCGGGTCCTATGACTAAGGATGAGATCAAGAGACATTTGGGTCTAACA
AAAGCAGATAAGGTGGAGAAGATTGAATGTGATGAGAAGCAAGAACTGAGAAATAAGCTTGAGGAATCAGAGGAGAAGAT
CAGAAACTTAGAAGCAGAGATCAAAACGTTGAGAGAGAGTAAGGAAGCGGTAGAGGCAGAGATGGAAACGGAGAAATCGA
TGAAGGGAGATCTTGATACAAATCTGAACATAATAAGAGCTAAGCTCAACGAGACACAGAAGAAGTTGTCTTCTCTTGAA
GTAGAACTTGATTACAGAAAGAGCTGTTGTGAAGAACTCGAAGGAACTTGCATAGAGCTTCAGCTTCAGCTAGAAAGTGT
TGAAACGAAGAAACCGACGCAGAGAAACAAAAACGGATGGGATATAGCAACAGCTTCTGTGAAGTTATCAGAGTGTCAAG
AGACGATTACCAATTTACGGAAGCAACTACGAGCGTTATCTACAACAGAAACAAGCAGCACCATGAAATTTCTACACAAA
AGATCTTCTCTCCGGGAAAATATAGAAGACTCAACGGCAAAAGATTCATCATACAAAGCAGAGGATGATAATAACCGAGT
TTCTCATGATGATGATGGTAACCATTACAATGCTTTGATCGTGTACGAACCAGTGAAGGCGAGAGGTGAGAAGATGGAGA
TGGTACAGAGAAAGAAGCAAGGATTAGGGTTCTTGAAAAAACTGTTGTTCAGGAGGAAAAGAGTGAGCAGCAAGAAATGT
CTTGCCTTGACTATGTGA