Details for Lyrate rockcress Locus 16056285

Position : sca3 ( 5`- 9531577 .. 9533858 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342300 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056285

Protein [Map View]
MANHDHPTHVPCLFSMMMSEGSRLSLSNQSLFSFPDPFLIWVVDQFHQRHSPDLTESSPLQYLYSFVMSIQWNCVFLPRR
RFVFGAFPWRRWFFRLSTGDCPLTQGYGGFTWIFDPGINRVLAEDEDIIKLVETKKNSQTQWINSGDLVPLFGHSIPEFP
AHRYPRSMLKDLRLATKRELTAHPMIPKKYLVQRKASSSQCFVHDYMRRRPHMMILHQPFMNVILEYDASEDEFGFLLKI
DEASTSPRWPLVFLDWVLVYLGSQVDSMNGMSDFKKRKHLPWQQIWVIRQRRLPTDQSESFSESSNVLISTKRQDTVLSP
TTLSSHFKSKVMLKAFWSLSSKLIANNKYVKEGHNRFHLLARKAFDSRYMDVEFNISMHCNECERKIARVISKFKGVETF
VTDMINHKVMVKGKIDPNKLLKKLKKKTGKRVKIVVKEEKDEESSKEDENVLEIDMESIGLRDQSIFGFCDWEMEKFMVF
SDENANAICSIS*

DNA
ATGGCAAATCACGACCATCCCACCCATGTTCCTTGTCTATTTTCGATGATGATGTCTGAAGGATCGCGCCTCTCGCTCTC
AAATCAGAGTCTGTTCTCCTTCCCGGATCCATTCCTGATTTGGGTTGTGGATCAATTCCATCAGAGACATTCGCCAGATC
TGACAGAGTCATCTCCTCTACAATATCTCTATTCCTTTGTAATGTCGATTCAATGGAATTGTGTTTTCCTTCCACGGAGA
AGGTTTGTTTTCGGTGCTTTCCCTTGGCGCCGGTGGTTTTTCCGGTTATCAACCGGTGATTGTCCTCTTACCCAAGGGTA
TGGAGGTTTCACTTGGATATTTGATCCCGGCATCAATAGAGTTTTGGCGGAAGATGAGGATATCATCAAACTAGTGGAAA
CAAAGAAGAACAGTCAAACACAATGGATTAATTCTGGTGATCTTGTGCCGCTATTTGGCCATTCTATACCGGAATTCCCT
GCGCATCGCTACCCAAGATCTATGCTCAAAGATCTTCGATTGGCGACAAAGAGGGAATTAACGGCGCACCCGATGATTCC
CAAGAAGTATCTGGTCCAACGAAAGGCTTCTTCTTCACAGTGTTTTGTTCACGATTACATGAGGAGACGACCGCATATGA
TGATTTTACACCAACCATTTATGAACGTCATCCTTGAATACGATGCATCAGAAGACGAATTTGGTTTTCTATTGAAGATA
GATGAAGCCTCGACCTCGCCTAGATGGCCACTTGTTTTTTTGGATTGGGTCTTGGTTTATCTCGGTTCACAAGTAGATTC
CATGAATGGCATGTCTGATTTTAAGAAGAGAAAACATTTACCATGGCAACAAATATGGGTGATAAGACAAAGGCGACTAC
CCACTGATCAAAGCGAGTCTTTCTCGGAGTCGTCAAATGTATTGATTTCAACGAAGCGACAAGATACAGTATTATCTCCA
ACAACATTAAGTTCACATTTCAAAAGTAAAGTAATGCTAAAGGCATTTTGGAGTCTCAGCAGCAAGCTGATAGCCAATAA
CAAGTATGTGAAAGAGGGACATAACAGATTTCATCTGTTAGCCCGTAAGGCTTTTGATAGCAGGTATATGGATGTCGAAT
TCAATATATCGATGCATTGCAACGAATGCGAGAGAAAAATCGCTAGAGTTATTTCCAAATTCAAAGGAGTTGAAACGTTT
GTGACGGATATGATTAATCATAAGGTTATGGTCAAGGGTAAGATTGATCCGAACAAGTTGTTGAAGAAACTCAAGAAGAA
GACTGGTAAAAGAGTGAAGATTGTAGTAAAGGAAGAGAAAGATGAAGAATCTAGTAAAGAGGACGAAAATGTTCTCGAGA
TTGATATGGAATCGATTGGTTTAAGGGATCAGTCGATTTTCGGGTTTTGTGATTGGGAGATGGAGAAATTTATGGTGTTT
AGCGATGAAAACGCCAATGCCATTTGTTCTATTTCTTAG