Details for Lyrate rockcress Locus 16056241

Position : sca3 ( 5`- 1539988 .. 1538269 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477706 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056241

Protein [Map View]
MSIPPSSASSSSSSSSQYTYAANSYYSAPYQPPQPYAAAPSPAVPSPVASVPGATVYSQPVGPVPAVYAYPQYQQAHQLF
QRDAQTITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLSEWPENDYRLFCGDLGNEVNDDVLSKAFTRF
PTFNMAKVIRDKRTGKTKGYGFVSFSNPADLAAALKEMNGKYVGNRPIKLRKSSWKERTDQEAAERQKHHSNKKQKTVKK
SVLHK*

DNA
ATGTCAATCCCACCATCTTCAGCTTCTTCTTCTTCATCTTCCTCGTCTCAGTACACATACGCTGCTAATTCTTACTATTC
CGCTCCGTATCAGCCTCCACAGCCTTACGCGGCGGCGCCTTCGCCTGCTGTACCGTCGCCGGTGGCATCTGTTCCCGGAG
CTACGGTCTATTCTCAGCCTGTTGGACCGGTTCCTGCCGTCTACGCTTACCCACAGTACCAGCAGGCACATCAATTGTTT
CAGAGAGATGCACAGACAATTACGCCAGAAGCTCTTGAGAATGTAAAAGCTGCTTTGGCAAGTAGTGAAACCGAACACAA
AGCAGAAACTAAAAAGAGAGCCATTCCTCGTAAAGCTGCTGGACAGTCTTGGGAGGATCCTACTCTTTCAGAGTGGCCAG
AAAATGACTATCGCCTGTTCTGTGGTGATCTTGGGAATGAAGTGAATGATGATGTTCTTTCCAAGGCATTTACTCGATTC
CCCACCTTCAATATGGCCAAGGTCATTAGAGATAAGCGGACTGGTAAAACCAAGGGTTATGGGTTTGTGAGTTTCTCAAA
TCCTGCGGATCTAGCAGCAGCCCTAAAAGAAATGAATGGTAAGTATGTTGGAAACCGTCCTATCAAACTACGAAAGAGCA
GCTGGAAAGAGAGGACAGACCAGGAGGCTGCTGAAAGACAAAAGCATCACAGCAATAAGAAGCAAAAAACTGTGAAGAAG
AGCGTACTTCACAAGTGA