Details for Lyrate rockcress Locus 16056230

Position : sca3 ( 5`- 10363573 .. 10364859 -3` )
Annotation : [B2G] cbl-interacting protein kinase 7
External links : CoGe
PGDD synteny : 16056230

Protein [Map View]
MESLPPPQNQTSSATTPAKTLLGKYELGRRLGSGSFAKVHLARSIESDELVAIKIIEKKKTIESGMEPRIIREIDAMRRL
RHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDQQ
GNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGNVPFDDSNIAAMYRKIHR
RDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNIFDSEPEMKSSVNSITAFDLISLSSGLD
LSGLFEVKKKKERRFTAKVSAVEVEEKAKMIGEKLGYVVKKKMKKEGEAKVVGLGRGRTVIVVEAVELTVDVVVVEVKVV
EGEEDDSRWFDLITELEDIVLSWHNDIM*

DNA
ATGGAATCACTTCCTCCGCCGCAAAACCAAACATCTTCGGCAACAACTCCGGCAAAAACTCTCCTCGGAAAATACGAACT
CGGTCGTCGACTCGGTAGCGGAAGCTTCGCGAAAGTCCATTTAGCTCGATCAATCGAATCCGACGAGCTCGTCGCCATTA
AAATCATCGAGAAGAAGAAAACAATCGAATCCGGTATGGAACCAAGAATAATCAGAGAGATCGATGCGATGCGTCGTCTT
CGTCATCATCCAAACATACTCAAGATCCATGAAGTTATGGCAACCAAATCTAAGATCTATCTCGTAATGGAACTCGCTTC
CGGTGGTGAACTTTTCTCTAAAGTCCTCCGTCGTGGTCGTCTTCCTGAATCAACGGCGCGTCGTTACTTTCAACAACTCG
CTTCCGCGCTTAGATTCTCTCACCAAGACGGTGTCGCTCACCGTGATGTGAAACCTCAGAATCTACTCTTAGATCAGCAA
GGTAACCTCAAGGTCTCTGACTTCGGTTTATCAGCTTTACCGGAACATCTCCAAAACGGATTGCTTCACACGGCGTGTGG
AACTCCGGCTTACACAGCTCCGGAGGTTATTTCGCGGCGAGGATACGACGGAGCAAAAGCTGATGCGTGGTCTTGTGGTG
TGATTTTGTTTGTTCTTTTGGTTGGCAACGTTCCATTTGATGATTCGAATATCGCAGCGATGTATCGGAAGATTCATCGG
AGAGATTATCGATTTCCGAGCTGGATTTCGAAACAAGCTAAATCGATAATCTATCAGATGTTAGATCCAAATCCAGTAAC
GAGAATGAGTATTGAAACAGTTATGAAAACGAATTGGTTCAAAAAATCTCTAGAAACTTCTGAGTTTCATCGTAACATCT
TTGATTCGGAACCGGAGATGAAATCGAGTGTTAATTCGATTACTGCTTTCGATTTGATCTCGTTGTCGTCGGGGTTAGAT
CTTTCTGGATTGTTTGAGGTTAAGAAGAAGAAGGAGAGGAGATTCACCGCGAAGGTTTCGGCTGTTGAAGTGGAGGAGAA
AGCGAAGATGATTGGGGAGAAGTTAGGTTATGTAGTGAAGAAGAAGATGAAGAAAGAAGGAGAAGCGAAGGTTGTTGGAT
TAGGGAGAGGAAGAACTGTGATTGTGGTGGAAGCGGTTGAGTTAACGGTGGATGTTGTGGTGGTTGAAGTGAAAGTTGTT
GAAGGTGAAGAAGATGATTCACGGTGGTTTGATTTGATTACAGAGCTTGAAGATATAGTTCTTTCATGGCACAATGACAT
CATGTAA