Details for Lyrate rockcress Locus 16056221

Position : sca3 ( 5`- 3354937 .. 3352150 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478146 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056221

Protein [Map View]
MTETGDDLATVPTSVTKSIPFLVIFKDLRHVFSRDTIGREILGMAFPTALALAADPIASLIDTAFVGRLGAAQLAAVGVS
IAIFNQASRITMFPLVSLTTSFVAEEDTMEKMKEEANKASLVHAETILVQDSLEKGISSPTSNNTNQPQQLPALDTKSNS
GNKATKKGKRTIRTASTSMILGLILGLVQAIFLIFSSKLLLGFMGVKPNSPMLSPAHKYLSIRALGAPALLLSLAMQGVF
RGFKDTKTPLFATVVADVINIALDPIFIFVLRLGISGAAIAHVISQYFMTLILFVCLAKKVNLIPPNFGDLQFGRFLKNG
ILLLARTIAVTFCQTLAAAMAARLGTTPMAAFQICLQVWLTSSLLNDGLAVAGQAILACSFAEKDYNKVTAVASRVLQMG
FVLGLGLSVFVGLGLYFGSGIFSKDPAVIHLMTIGIPFIAATQPINSLAFVLDGVNFGASDFAYTAYSMVGVAAISIGAV
IYMAKTNGFIGIWIALTIYMGLRAITGIARMATGTGPWRFLRGRSTSSSS*

DNA
ATGACGGAAACTGGTGATGATCTTGCTACGGTTCCAACCAGCGTGACCAAGTCAATCCCATTTCTTGTTATCTTCAAAGA
TTTAAGACATGTATTCAGTAGGGATACAATTGGGCGAGAGATTCTAGGCATGGCGTTTCCAACAGCTTTGGCTTTAGCTG
CTGATCCAATCGCTTCTCTGATTGATACCGCTTTTGTCGGGCGTTTAGGAGCGGCTCAGCTAGCGGCGGTTGGAGTCTCC
ATTGCCATATTCAATCAAGCATCTAGAATTACGATGTTCCCACTTGTGAGCCTCACGACTTCGTTTGTGGCAGAGGAAGA
CACGATGGAGAAGATGAAAGAAGAAGCGAACAAAGCCAGTCTTGTTCATGCAGAAACTATACTTGTTCAAGATTCCTTGG
AAAAGGGCATTTCTTCACCTACAAGTAACAATACCAACCAGCCACAGCAACTCCCAGCTTTGGATACAAAGTCAAATAGT
GGAAACAAAGCGACTAAAAAGGGGAAGAGGACCATTAGAACAGCATCAACATCTATGATATTGGGGTTAATCCTCGGCCT
TGTGCAAGCTATTTTCTTGATTTTCAGCTCCAAGTTGCTTCTAGGCTTCATGGGAGTGAAACCAAATTCGCCAATGTTAT
CACCAGCACACAAGTACTTGAGTATACGAGCTTTGGGGGCCCCTGCATTGCTTCTATCTCTTGCTATGCAAGGCGTCTTT
CGTGGCTTCAAGGATACCAAAACTCCTCTCTTTGCCACTGTCGTAGCAGATGTTATCAACATCGCTCTCGACCCCATCTT
CATTTTTGTGCTTCGTCTCGGGATCAGCGGTGCAGCCATTGCCCATGTCATTTCTCAGTACTTCATGACTCTAATATTGT
TCGTCTGCCTCGCAAAGAAAGTTAATTTGATTCCACCAAACTTCGGGGATTTGCAGTTCGGAAGGTTCCTTAAAAATGGG
ATACTATTGCTGGCGAGGACTATAGCAGTGACGTTTTGTCAGACCTTAGCAGCAGCAATGGCGGCTCGGCTGGGTACAAC
ACCAATGGCTGCTTTTCAGATTTGTTTACAAGTCTGGTTAACTTCTTCTCTTCTCAATGATGGTCTTGCCGTTGCTGGTC
AGGCGATCCTGGCTTGTTCGTTTGCTGAGAAGGACTATAACAAAGTGACTGCTGTTGCATCCCGTGTTCTACAGATGGGT
TTTGTGTTAGGACTTGGACTGTCCGTTTTTGTTGGACTAGGTCTCTACTTTGGTTCCGGAATATTCTCCAAGGACCCTGC
TGTTATTCACCTCATGACCATTGGAATACCGTTTATAGCAGCCACGCAACCAATAAACTCACTCGCCTTTGTATTGGATG
GAGTCAATTTTGGAGCATCTGATTTTGCTTACACTGCATACTCCATGGTGGGAGTGGCGGCCATAAGCATTGGAGCAGTA
ATATATATGGCAAAGACCAATGGTTTCATAGGAATATGGATAGCTCTTACAATCTATATGGGTCTCCGTGCTATTACTGG
AATTGCAAGGATGGCAACAGGAACTGGACCGTGGAGGTTCTTGCGTGGAAGATCAACCTCTTCATCTTCCTAG