Details for Lyrate rockcress Locus 16056158

Position : sca3 ( 5`- 10785506 .. 10799051 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056158

Protein [Map View]
MTQADLGLADAYINGDFLFVNKETGLLNLIMILIASKELNSNLAKKRGRWTPMFLTTGLASAKHFLKHFYRQNNITQARR
NISRHYDLSDDEDLKTAQMRKIYLLIDKSRIEKNHEVLDIGCGWGTLAIEAVRRTGCKYTGITLSIEQLKYAEEKVKQAG
LQDRITFKLCDYRQLSDAQKYDRIISCERLEHVGHKFMETFFSHCEAALAEDGIFVLLFISIPEERYNEYRLNSDFIKEY
IFPGGCLPSLARVTSAMSSSSRLCIENVENIGIHYYQTLRLWRKNFLERQKQIIDLGFDDKFIRIWEYYFDYCAAGFKTL
TLGPWRLPDIFLTSRERSCIR*

DNA
ATGACACAGGCTGATTTAGGACTTGCTGATGCTTATATCAATGGAGATTTTTTGTTTGTCAATAAGGAAACAGGACTATT
GAATCTGATAATGATTCTCATTGCTAGCAAAGAATTGAACTCAAATCTTGCTAAGAAAAGGGGCCGGTGGACACCGATGT
TTTTGACTACTGGTTTAGCATCTGCAAAGCATTTCCTAAAGCATTTCTATAGGCAGAACAATATAACTCAAGCTCGAAGG
AACATTTCGCGACACTATGACCTTTCGGATGATGAAGATTTGAAGACTGCACAAATGAGAAAAATATATCTTCTCATTGA
TAAGTCGAGGATAGAGAAGAACCATGAGGTCTTAGATATTGGATGCGGATGGGGAACTTTGGCCATAGAAGCTGTGAGAA
GAACTGGATGCAAATATACCGGTATTACGCTATCAATTGAACAACTTAAGTATGCAGAAGAAAAAGTGAAACAAGCTGGA
CTTCAGGACCGGATTACGTTTAAGCTCTGCGATTATCGCCAACTATCTGATGCTCAAAAATATGACAGAATTATATCTTG
CGAGAGGCTAGAACATGTTGGCCACAAATTCATGGAGACATTTTTCAGTCACTGTGAAGCTGCGCTTGCGGAAGACGGCA
TTTTTGTCTTGCTGTTTATATCGATACCCGAAGAACGTTACAATGAGTACAGACTAAATTCAGATTTCATAAAAGAATAC
ATATTCCCAGGTGGATGCCTTCCTTCTTTAGCCAGAGTTACTTCAGCCATGTCCTCTTCTTCTAGGCTATGCATTGAAAA
TGTTGAGAACATTGGGATTCATTACTACCAAACGCTGAGATTGTGGAGGAAGAATTTCTTGGAGAGACAAAAACAAATCA
TCGATCTTGGATTCGACGATAAATTCATTAGGATATGGGAATATTATTTCGACTATTGTGCAGCTGGTTTCAAGACTCTT
ACCCTTGGTCCTTGGAGACTACCAGATATTTTTCTCACGTCCAGGGAACGTAGTTGCATTCGGTGA