Details for Lyrate rockcress Locus 16056127

Position : sca3 ( 5`- 4434603 .. 4435655 -3` )
Annotation : [B2G] dre-binding protein 2b
External links : CoGe
PGDD synteny : 16056127

Protein [Map View]
MAVYEKTGTDTPKKRKSRARADGSTVADRLKKWKEYNEILEVSAIKEGEKPKRKVPAKGSKKGCMKGKGGPDNSHCSFRG
VRQRIWGKWVAEIREPNRGQRLWLGTFPTAEEAAAAYDEAASVMYGPLARLNFPQSVGSELTSTSSQSEVCTVENKAVLC
GDVCVKHEDIDCESKPCSQILDVREESCVTRPDSCAVGHHDTNSVLNYDLLLEFEQQYWSETLQEKEKPKQEEEEIQQKK
RRYSNINSNISNRICLLLQIMILWDPNELFDIDELLGDMNGGMLPGPDQSQDPNHVNSGSYDLHPLHLEPHDGHEFDGLS
TLDL*

DNA
ATGGCTGTATATGAAAAAACCGGAACCGATACACCGAAGAAAAGGAAATCTAGGGCTCGAGCAGATGGTTCAACGGTGGC
TGATAGGTTAAAGAAGTGGAAAGAGTACAACGAGATTCTTGAAGTTTCGGCTATTAAAGAAGGAGAGAAACCGAAACGCA
AGGTTCCTGCGAAAGGGTCTAAGAAAGGTTGTATGAAGGGTAAAGGAGGACCAGATAATTCTCACTGTAGTTTTAGAGGA
GTTAGACAAAGGATTTGGGGTAAATGGGTTGCAGAGATACGGGAACCGAATAGAGGACAAAGACTTTGGCTTGGTACTTT
TCCTACCGCGGAAGAAGCTGCTGCCGCTTATGATGAAGCCGCTAGTGTTATGTATGGTCCATTGGCTCGTCTTAACTTCC
CTCAGTCTGTTGGGTCTGAGTTAACTAGTACATCGAGTCAGTCTGAGGTGTGTACGGTTGAAAATAAGGCGGTTCTTTGT
GGTGATGTTTGTGTGAAGCATGAGGATATTGATTGTGAATCTAAACCATGTAGTCAGATTTTAGATGTTAGGGAAGAGTC
TTGTGTAACCAGGCCGGACAGTTGCGCGGTTGGACATCATGATACGAATTCTGTGCTGAATTACGATTTGCTGTTAGAGT
TTGAGCAGCAGTATTGGAGCGAAACTTTGCAGGAGAAAGAGAAACCGAAGCAGGAAGAAGAAGAGATACAGCAGAAGAAG
AGGAGATACAGCAACATCAACAGCAACATCAGCAACCGGATTTGCTTACTGTTGCAGATTATGATTCTTTGGGATCCTAA
TGAGTTATTTGATATTGACGAACTCCTTGGAGACATGAATGGAGGCATGTTACCTGGTCCCGATCAGAGCCAGGACCCAA
ACCATGTAAATTCTGGTAGTTATGATTTGCATCCGCTTCATCTCGAGCCACACGATGGTCACGAGTTCGATGGTTTGAGT
ACTCTGGATCTTTGA