Details for Lyrate rockcress Locus 16056114

Position : sca3 ( 5`- 1745798 .. 1747242 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056114

Protein [Map View]
MAGVAGQISISRSSTLRRVNHRPRCFSGSPENKTPAVLKWAVGGVTELLRLFSGAPSSSSIPTNKDRSRYELSAGNVEDV
MEILRSDYRNAYFVTGILTSSIYSDECIFEDPTISFQGTELYERNLKLLVPFLEDASIELQNMDKSESSERNYILATWKL
RTYLKLPWRPLISINGSTVYDLDRDFKIVRHVESWNVSALEAVGQIFTVKSFPFGD*

DNA
ATGGCGGGAGTGGCTGGCCAGATATCTATCAGCCGATCGTCGACCTTGAGGAGGGTTAATCATCGGCCGCGATGCTTCTC
TGGTTCGCCGGAGAATAAAACACCGGCTGTTTTGAAGTGGGCGGTTGGTGGAGTCACTGAGTTGCTTCGGCTGTTCTCCG
GTGCGCCGTCTTCATCCTCCATCCCTACAAATAAAGATAGATCAAGGTATGAGCTTTCTGCTGGAAATGTTGAGGATGTG
ATGGAGATTTTGAGATCAGATTATCGAAATGCCTACTTCGTCACAGGAATCTTGACTTCTTCAATTTACTCGGATGAATG
CATCTTCGAGGATCCGACTATCAGCTTCCAGGGTACAGAGTTGTATGAACGCAACTTGAAATTACTTGTTCCGTTCCTCG
AAGATGCATCCATTGAACTGCAAAATATGGACAAGAGTGAGTCGTCCGAAAGAAACTATATACTGGCGACATGGAAGCTA
AGGACTTACCTGAAACTTCCATGGAGACCACTAATATCGATCAACGGAAGTACGGTATATGATCTGGATCGAGACTTCAA
AATTGTGAGGCATGTCGAGAGCTGGAATGTCTCTGCGCTAGAAGCAGTCGGGCAGATATTCACCGTCAAGTCTTTTCCCT
TCGGTGACTGA