Details for Lyrate rockcress Locus 16056111

Position : sca3 ( 5`- 1259723 .. 1255977 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056111

Protein [Map View]
MVFKSRIKWIALFVLILSMGSLVVHLSMTKSSGVQLAYSARDNLWQDFDSLLGAQDFRNKHLWRPVKSLETLQPYANPRN
SYPAPSSTNNRFIYAKIFGGFDKIRSSICDLVTISRLLNATLVIPELQESLRSKGISNKFKSFSYLYDEDQFIAFLKNDV
IVTKTLPESLKAARKRNEFPLFKPKNSASPKYYLEDVLPKLKKANVIGLIVSDGGCLQSTLPASMPELQRLRCRVAFHAL
QLRSEIQVLGKKMVDRLRKSGQPFLAYHPGLVREKLAYHGCAELFQDIHSELIQYRRAQMIKQKFILEELIVDSRLRRDN
GLCPLMPEEVGILLKALGYSQKAIIYLAGSEMFGGQRVLIPLRAMFPNLVDRTALCSTEELSELVGPETPLPENTFKMPP
RKSDKQLKEEWNKAGPRPRPLPPPPDRPIYQHEKEGWYGWLTENDTEPSPSPMDLRNQAHRLLWDALDFAVSVEADVFFP
GFNNDGSGWPDFSSLVMGQRLYERPSSRTYRLDRKVIQELFNITREDMYHPNRNWTLRVRKHLNSSLGESGLIRQSMLSK
PRSFLSHPLPECSCRTSALEDSRQIRSDDGRFLYGGEDECPKWIKSAGVEKSKTDDGDQPDYEHDLLAEQSETEEEFAKS
KVASAFDQDEEWDPND*

DNA
ATGGTGTTCAAATCTAGAATAAAATGGATTGCGCTTTTTGTGTTGATCTTATCAATGGGATCTCTGGTTGTTCATCTTTC
CATGACCAAGTCTTCCGGTGTACAGTTGGCGTATTCTGCAAGAGATAACCTTTGGCAAGATTTTGATTCTTTGTTAGGCG
CACAGGATTTTAGAAATAAGCACTTATGGCGACCTGTCAAATCGTTAGAGACCTTACAGCCTTATGCCAATCCAAGAAAT
AGTTATCCTGCACCCAGTTCAACAAACAATCGTTTCATTTATGCAAAGATATTTGGTGGATTTGACAAGATAAGATCTTC
TATATGTGATCTTGTCACCATATCCAGGCTTCTTAATGCTACTCTTGTCATTCCAGAGCTTCAAGAAAGTCTTCGCTCAA
AAGGCATTAGCAACAAGTTCAAGAGTTTCTCCTATCTTTATGATGAAGATCAGTTTATAGCCTTTCTTAAAAATGATGTT
ATAGTTACGAAGACCCTTCCTGAGAGCTTGAAAGCCGCAAGAAAAAGGAATGAGTTCCCTCTTTTTAAGCCCAAAAACTC
TGCATCACCAAAATATTACCTCGAGGATGTATTGCCAAAGTTAAAGAAAGCTAATGTTATTGGATTGATCGTCTCTGATG
GAGGATGCTTGCAGTCAACTTTGCCCGCTTCAATGCCTGAACTTCAAAGATTAAGGTGTAGAGTTGCCTTCCATGCCCTC
CAGCTTCGTTCAGAAATCCAGGTGCTGGGCAAGAAGATGGTTGACAGGTTACGTAAATCAGGTCAACCTTTCTTAGCTTA
TCATCCTGGCTTAGTAAGGGAGAAATTGGCATATCATGGTTGTGCTGAGCTTTTCCAGGATATTCACAGTGAACTCATCC
AATATCGGCGGGCTCAGATGATTAAGCAGAAGTTTATTTTAGAAGAACTTATTGTAGACTCACGCTTGCGCAGGGACAAT
GGCTTATGTCCTCTCATGCCAGAAGAGGTTGGAATTCTTTTGAAAGCATTGGGTTATTCTCAAAAAGCGATCATATACTT
AGCTGGTTCTGAAATGTTTGGCGGCCAACGGGTTTTGATCCCTCTGCGTGCCATGTTCCCTAATTTAGTGGATCGGACTG
CTTTATGCAGCACGGAGGAATTATCAGAATTGGTTGGTCCTGAGACACCTCTTCCAGAGAATACATTTAAAATGCCTCCT
CGAAAAAGCGATAAGCAACTCAAAGAAGAGTGGAACAAGGCAGGTCCTCGACCTCGACCTCTACCTCCTCCTCCAGATAG
ACCTATCTACCAGCACGAAAAAGAAGGATGGTATGGTTGGCTGACAGAGAATGACACAGAACCAAGCCCTTCACCTATGG
ATCTTAGGAATCAAGCACACAGGTTACTGTGGGATGCCCTCGATTTTGCTGTTTCTGTAGAAGCTGATGTGTTTTTCCCT
GGTTTCAACAACGATGGTAGTGGGTGGCCAGATTTTTCAAGTTTGGTGATGGGTCAGAGGCTCTATGAAAGACCCTCTTC
ACGAACATATAGACTGGACAGGAAAGTTATTCAAGAACTTTTCAACATTACTCGTGAGGACATGTACCATCCCAACCGTA
ACTGGACACTTCGTGTGAGGAAACATCTTAACTCGAGTTTGGGTGAAAGTGGGCTTATCAGGCAGTCTATGTTGTCAAAA
CCTAGGTCGTTCCTTTCGCATCCACTTCCTGAATGCTCATGCAGAACCTCGGCCCTTGAGGATTCCAGGCAAATACGGAG
TGATGATGGTAGATTTCTCTATGGAGGTGAGGATGAATGCCCTAAATGGATAAAATCAGCGGGAGTGGAAAAGAGTAAAA
CTGACGATGGTGATCAGCCTGATTATGAACATGACCTTCTCGCTGAACAGTCAGAAACTGAAGAAGAATTTGCAAAAAGT
AAGGTAGCTTCAGCTTTTGACCAAGATGAAGAATGGGATCCTAATGACTAG