Details for Lyrate rockcress Locus 16056056

Position : sca3 ( 5`- 2099364 .. 2102141 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477844 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16056056

Protein [Map View]
MGLGNKGNKFNFGDNDLADEGSAADGDSRDEGDGFGSVACSICLETVVKNGDRAWANLQCDHQFHLDCIGSAFNAKGVMQ
CPNCRKVEKGQWLYANGCRTYPEFSVEDWVHEEDIYDIGAYSELSFGVHWCPFGSSARLPSFEDGEFSPGSYHDLLGQQG
YYTEPAAPTAGHPCPYVTYFGPVHSSSSSSGGAAGVSDSSSFSSHWNTGSSVSGEVPTPYGFPVDPHYHGWDYHPPPPPP
PQHFSASGPHVGSPTQPTPPPAAARTSRTNGSDVIRPRPPHFTRPFHGHSSSGRAGSSVASVPRTPPFPGSNARTRDRMQ
ALQAYYQQSSAQSHQPDSPIVSRGPVFPSGRRPARGIASGMGSTSSSSDQAGGSGFIRFNIWERDPYMQSQQAYSINQMD
REPNIWTSSFNEGSGSFHQRHGGGGGSS*

DNA
ATGGGTTTAGGTAATAAGGGTAACAAATTCAATTTCGGTGATAATGATCTCGCCGACGAAGGTAGTGCTGCCGATGGCGA
TTCTCGCGACGAAGGTGATGGTTTTGGTTCTGTTGCGTGTTCCATTTGTCTCGAGACGGTTGTTAAAAACGGCGATCGAG
CTTGGGCTAATCTTCAATGTGACCATCAGTTCCATCTTGATTGTATTGGTTCTGCTTTCAATGCAAAGGGAGTGATGCAA
TGCCCCAACTGTCGGAAAGTAGAAAAAGGCCAGTGGCTTTATGCAAATGGTTGCCGTACATATCCTGAATTCAGTGTTGA
GGATTGGGTTCACGAAGAAGATATTTATGATATTGGAGCATACTCTGAATTGTCTTTTGGAGTTCACTGGTGCCCATTTG
GAAGCTCAGCCCGTCTTCCTTCTTTCGAGGATGGAGAATTTTCGCCGGGTTCATATCACGATCTTTTGGGACAGCAAGGT
TACTATACTGAACCAGCAGCGCCAACTGCAGGTCATCCATGTCCATATGTAACCTATTTTGGCCCGGTTCATTCGTCTTC
CTCAAGCAGTGGTGGTGCTGCAGGCGTTTCAGACAGTTCTAGTTTCAGTAGTCACTGGAACACTGGCTCTTCGGTTTCTG
GTGAAGTCCCAACTCCATATGGTTTCCCTGTGGATCCGCACTATCACGGCTGGGATTATCACCCGCCTCCACCCCCACCG
CCACAGCATTTCTCTGCTTCTGGCCCTCATGTGGGTAGTCCTACTCAGCCCACACCTCCACCAGCTGCTGCGAGGACTTC
TCGAACTAACGGTTCAGATGTGATCAGACCCAGACCGCCACATTTCACGCGTCCATTTCATGGTCACAGTTCCAGTGGTA
GAGCGGGTAGCTCGGTGGCATCTGTTCCGAGGACACCACCATTTCCAGGAAGCAACGCTCGGACCCGAGACAGAATGCAG
GCTCTTCAAGCGTATTACCAACAGTCTTCTGCACAGTCACACCAGCCGGATTCGCCTATAGTCTCTCGAGGACCTGTATT
CCCGTCTGGCCGGAGGCCCGCTAGAGGAATAGCTTCCGGGATGGGATCAACATCATCTTCTTCGGATCAGGCAGGCGGGA
GTGGTTTTATCCGGTTTAACATATGGGAGAGAGATCCTTATATGCAATCACAACAAGCCTACTCGATTAATCAGATGGAC
AGAGAACCAAACATTTGGACATCTTCATTTAACGAAGGATCAGGAAGCTTCCATCAGAGGCACGGGGGCGGAGGAGGATC
ATCGTAA