Details for Lyrate rockcress Locus 16056051

Position : sca3 ( 5`- 3304654 .. 3303882 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056051

Protein [Map View]
MARDSCLAKITAGVAVGGALGGAVGAVYGTYEAIRYRVPGLMKVRYIGQTTLGSAAVFGLFLGAGSLIHCGKGY*

DNA
ATGGCGAGAGATAGCTGTTTGGCCAAAATCACTGCCGGAGTTGCCGTTGGCGGCGCACTTGGCGGCGCAGTAGGTGCTGT
CTATGGAACTTACGAGGCGATTAGATACAGGGTTCCTGGGCTTATGAAGGTTAGATACATTGGGCAAACTACCCTCGGCA
GCGCAGCAGTTTTCGGGCTTTTTCTAGGTGCAGGCAGTTTGATACATTGTGGCAAAGGCTACTGA