Details for Lyrate rockcress Locus 16056050

Position : sca3 ( 5`- 991334 .. 992324 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056050

Protein [Map View]
MARSLKKSVKLSLRHVRVRLKQDSSSIERDQRIEFLGRDKGVGEEENDGDSSSSEYEEFEEEEEGGGEGEGEEQDDGKSV
VSGGKSGCGETEAAVEAAEAEITEAGNRVMVVVDKVIASTGALEWALKHTLQSQDYLFLLYFSKPFRKGKRKNRKSEVKT
DELVHTLKKLCQTKRPGIEVEIRRLEGKEKDKGEKIVEEAKEQQVSLLVVGEEKKPPVWRLLKRWGWKKRRGRAGVLKYC
LEKASCMTIAVKPKNRKLGGYLITTKRHKNFWLLA*

DNA
ATGGCAAGATCGCTCAAGAAATCAGTTAAGTTGAGCCTAAGACATGTCCGGGTCCGTTTGAAACAAGACTCTAGTTCCAT
AGAAAGAGATCAGAGAATTGAGTTTCTTGGACGAGACAAGGGGGTTGGAGAAGAGGAAAACGATGGTGACAGTAGCAGCA
GCGAGTATGAAGAGTTTGAAGAAGAGGAAGAAGGAGGAGGAGAAGGGGAAGGAGAGGAACAAGATGATGGCAAGAGCGTT
GTGAGCGGTGGAAAAAGTGGATGCGGGGAGACAGAAGCCGCGGTGGAAGCAGCAGAGGCGGAGATTACAGAGGCCGGGAA
TAGGGTGATGGTGGTGGTGGATAAAGTGATTGCATCAACTGGAGCTCTTGAATGGGCTTTGAAGCATACATTACAGTCAC
AAGACTATCTTTTTCTCTTATATTTCTCCAAACCCTTTAGAAAAGGCAAAAGGAAGAACCGGAAAAGTGAAGTAAAGACC
GATGAACTCGTCCATACTCTAAAGAAACTCTGCCAAACAAAGCGACCCGGGATAGAGGTTGAGATAAGAAGGCTAGAAGG
AAAAGAGAAAGATAAAGGAGAGAAGATAGTGGAAGAAGCTAAAGAACAACAAGTGAGTCTATTAGTGGTTGGAGAAGAGA
AGAAACCGCCGGTTTGGAGATTGTTGAAGAGATGGGGATGGAAGAAACGGCGAGGCCGAGCCGGAGTTCTCAAGTATTGC
CTAGAGAAGGCTTCATGTATGACCATTGCAGTTAAACCAAAGAACCGTAAGCTTGGTGGTTACCTGATCACAACCAAACG
TCACAAGAACTTTTGGTTGTTAGCTTGA