Details for Lyrate rockcress Locus 16056021

Position : sca3 ( 5`- 9128883 .. 9136070 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16056021

Protein [Map View]
MESILARALEYTLKYWLKSFTRDQFKLQGRTAQLSNLDINGEAIHASMGLPPALSVTTAKVGKLEIMLPYVSNVQTEPVV
VQIDKLDLVLEENPDADVTKGPSSSQSPTAAKSNGYGFADKIADGMTLQVKVVNLLLETGGGAHREGGAAWAAPLASITI
RNLVLYTTNESWKVVNLKEARDFSTNTGFIYLFKKLEWEALSIDLLPHPDMFTEANLARSEEENLRDDDGAKRVFFGGER
FLEGISGQAYITVQRTALNSPLGLEVQLHIPEAVCPALSEPGLRALLRFLTGMYLCLNRGDVDPKSQQSAEAAGRSLVSV
LVDHVFLCIKDAEFQLELLMQSLLFSRACVSDGESANYLTKILIVGLFLRDAFSRAPCALVQPSMKTAAEDLAIPEFAKN
FCPLIYPLDSGPWQIVQDVPLISLHSLQVKPSPKPPHFFSKTVIQCQPLMVHLQEEACLRISSFLADGIVVNPGDVLPDN
SVNSLLFTLKELDVSVPLDLSNLEDSAIKEDLSIKKSFIGARLHIENLSFAESPTLKVRLLNLEKDPACFCLWPGQPIDA
SQKKWTAGASHFSLALETSPNSTELQSPRGPEMGLWNCVEGKDVSIEVAMVSADGKPLITIPPPGGIVRIGVACEQYISR
ASVEQLFFVLDLYSYFGKVSEKISIVKESKRQNTVSLTGGLLEKVPSDTAVKLALKDLQLKFLESSFTSTQDMPLVQFLG
KDLSVKVTHRTLGGAVAVSSNIYWENIEVDCVDTDLQQEHENSWNGHLVSCNGSTPLRRVFWVVNGRHDGHSGSTVMTPF
LDISITHVIPLSEKDMECHSVSIVACISGVRLGGGMSYAEALLQRFGILNLDGGPGEGLSRGLEHLSSGPLSKLFKSSIV
DDRKKDGTPGNWNGDGFPHLKRPDDIDVSIELRDWLFALEGREGVGTGILNNEDIGREERCWHTNFRTFRVLAKSTPKNV
DPNGTENQYDAHKYPVDSIIVSVEGLQTVKPQMQKGTDSCNGLSTNGVHENGHMHGGVNIEANIVASEDKSVHDDSLNWV
AESLKFSVKQPVEAIVTKDELQHLTFLCKSEVDAMGRIVAGVLRVLKLEESIGQATLNQLSNLGSEGFDKMFSPKASRAG
SPKSSPFAASSDSMREISLRTNLESTISSIEEASMELEAKCSALVSDLNDSESSAKHANELKQKLESLQSLMAKLRTQI*

DNA
ATGGAGTCGATACTGGCTCGAGCCTTAGAGTATACACTCAAGTATTGGCTCAAATCGTTTACCAGAGATCAGTTTAAGCT
TCAAGGCCGTACCGCTCAGCTTTCTAATTTAGACATTAATGGTGAGGCTATACATGCCAGTATGGGTTTGCCACCTGCCC
TTAGTGTGACCACTGCCAAAGTTGGAAAATTGGAAATCATGCTTCCATATGTCAGTAATGTACAAACGGAACCCGTTGTT
GTGCAAATCGATAAACTTGATCTTGTTCTTGAAGAAAATCCTGATGCTGATGTGACAAAGGGTCCAAGCAGTAGTCAGTC
TCCTACCGCCGCAAAAAGTAACGGGTATGGATTTGCTGACAAGATTGCAGATGGAATGACTTTACAAGTTAAGGTGGTCA
ATCTTCTTCTTGAAACTGGAGGTGGTGCCCACCGTGAAGGAGGGGCAGCCTGGGCTGCTCCGCTGGCATCTATTACAATT
CGTAACCTTGTTCTGTACACCACTAATGAGAGTTGGAAGGTTGTAAATCTGAAAGAAGCAAGGGACTTCTCTACTAACAC
AGGATTTATTTATTTGTTTAAGAAACTTGAATGGGAAGCTTTATCAATTGATCTTCTACCACATCCTGATATGTTCACTG
AAGCTAATTTAGCCCGGTCTGAAGAAGAAAATCTCAGAGATGATGATGGTGCAAAACGAGTATTCTTTGGTGGAGAACGC
TTTTTAGAAGGAATTTCTGGCCAAGCATATATCACAGTTCAGAGAACAGCACTAAACAGTCCACTTGGGCTTGAAGTCCA
GTTGCACATTCCAGAAGCTGTTTGTCCAGCCTTAAGTGAACCAGGGTTGCGCGCTCTTCTCCGCTTTCTAACTGGAATGT
ACTTATGCCTTAACCGAGGAGATGTGGATCCAAAATCTCAGCAGTCTGCCGAAGCAGCAGGACGTTCTCTTGTCTCCGTT
CTTGTGGACCATGTATTTCTTTGCATTAAAGATGCTGAATTCCAACTGGAACTACTAATGCAATCACTCCTTTTTTCTCG
GGCCTGTGTTTCGGACGGAGAATCAGCTAACTATTTGACTAAGATTTTGATTGTTGGGCTATTTTTAAGGGATGCCTTTT
CGCGCGCTCCTTGTGCTCTAGTCCAACCATCCATGAAAACTGCTGCCGAAGACCTTGCAATTCCCGAATTTGCCAAGAAT
TTTTGCCCTCTCATATATCCATTGGACAGCGGCCCGTGGCAAATAGTTCAGGATGTACCCTTGATCTCCCTACACTCTCT
TCAGGTCAAGCCATCCCCAAAACCTCCACACTTTTTCTCAAAGACAGTTATCCAGTGCCAACCACTCATGGTTCATCTTC
AGGAAGAAGCTTGTTTAAGAATTTCATCTTTTCTGGCTGATGGCATTGTTGTAAATCCCGGTGATGTTTTGCCTGATAAC
TCTGTTAACTCTCTTCTTTTCACGCTCAAGGAGTTAGATGTCTCTGTTCCATTAGACCTGAGTAACTTGGAAGATTCAGC
AATCAAAGAAGACCTTTCCATAAAAAAGTCCTTCATTGGGGCGAGGCTTCATATTGAGAATTTATCTTTTGCAGAGTCAC
CTACTCTTAAAGTTCGGCTACTAAACCTGGAGAAGGATCCTGCTTGCTTCTGTCTTTGGCCAGGACAGCCTATTGATGCC
AGCCAAAAGAAATGGACAGCTGGAGCCTCACATTTTAGTTTGGCTTTGGAAACATCTCCCAACTCAACTGAACTTCAGAG
CCCTCGTGGTCCGGAAATGGGTTTGTGGAATTGTGTTGAAGGAAAAGACGTGTCTATAGAAGTTGCTATGGTATCTGCGG
ATGGAAAGCCACTGATAACAATTCCTCCTCCTGGTGGTATTGTACGCATTGGAGTTGCTTGTGAGCAATATATCTCGCGT
GCTTCAGTGGAACAGTTATTTTTTGTTCTGGACCTCTATTCTTACTTCGGTAAGGTCAGTGAAAAGATTTCAATTGTTAA
AGAAAGCAAACGCCAGAATACTGTTTCTTTGACTGGAGGGTTGTTGGAGAAGGTTCCCAGTGATACTGCTGTAAAATTGG
CTTTGAAGGATTTGCAGCTTAAGTTTCTGGAGTCTTCCTTTACTAGTACACAGGACATGCCACTCGTTCAGTTTCTTGGC
AAAGATCTTTCTGTGAAGGTAACTCATAGAACCCTTGGTGGTGCTGTTGCAGTATCCTCCAACATATACTGGGAAAATAT
TGAGGTAGATTGCGTAGATACCGACTTACAACAAGAACATGAGAATAGCTGGAATGGTCACTTAGTTAGCTGTAATGGGT
CTACCCCACTGAGGCGCGTCTTTTGGGTTGTCAACGGGAGACATGATGGGCATAGTGGCAGCACTGTTATGACACCTTTT
CTGGACATAAGCATAACACATGTGATTCCCCTCAGTGAAAAGGATATGGAATGCCACAGTGTAAGCATTGTGGCTTGTAT
TTCAGGTGTACGCCTAGGAGGTGGAATGAGCTATGCTGAAGCTCTATTACAACGATTCGGAATTCTGAATCTTGATGGTG
GTCCAGGAGAGGGTCTGTCTAGAGGATTAGAGCATTTATCTTCTGGACCTTTGTCAAAACTTTTCAAATCATCTATAGTT
GATGACAGGAAAAAGGATGGAACTCCAGGAAACTGGAATGGCGATGGTTTCCCACATTTGAAAAGGCCAGATGACATTGA
TGTCTCTATTGAGTTAAGAGACTGGTTGTTTGCTTTGGAGGGCAGAGAAGGTGTTGGCACAGGAATTCTGAATAATGAAG
ATATTGGAAGAGAAGAGAGGTGTTGGCACACTAATTTTCGTACTTTCCGAGTACTAGCCAAGAGTACACCGAAGAATGTG
GATCCAAATGGGACAGAAAACCAGTATGATGCTCACAAGTATCCTGTGGACTCAATTATTGTCAGTGTCGAAGGTCTACA
GACAGTGAAGCCTCAAATGCAGAAAGGGACCGATTCTTGTAATGGTTTGTCTACAAATGGAGTTCACGAAAACGGTCACA
TGCATGGAGGGGTTAACATTGAAGCTAATATTGTGGCATCCGAAGACAAATCTGTTCATGATGACTCATTGAACTGGGTG
GCAGAAAGTCTGAAATTCTCTGTTAAGCAACCTGTTGAGGCAATTGTTACAAAGGATGAGCTGCAGCATTTGACATTCTT
GTGCAAATCTGAAGTTGACGCAATGGGAAGGATAGTCGCAGGGGTTTTACGTGTGCTGAAACTTGAAGAATCTATTGGCC
AGGCGACTCTAAATCAACTAAGCAACCTTGGAAGTGAAGGTTTTGACAAAATGTTCTCTCCAAAAGCAAGCAGAGCAGGA
AGTCCCAAAAGCTCACCTTTTGCTGCATCATCAGATTCGATGAGAGAAATTTCTTTACGTACAAACCTCGAATCTACCAT
TTCTTCCATTGAAGAAGCCTCAATGGAGTTAGAGGCCAAGTGTTCAGCTCTAGTTTCTGATCTCAATGATTCAGAATCTT
CGGCAAAACACGCCAACGAGCTCAAGCAGAAACTCGAGAGCTTGCAGAGCTTAATGGCTAAATTACGAACCCAAATCTAA