Details for Lyrate rockcress Locus 16055966

Position : sca3 ( 5`- 9426110 .. 9432161 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055966

Protein [Map View]
MYKGSSKRGGRGGNGGGSGGPSRNRNSFPPPTNRHPSPVGRMSSGGGGGSAAAPRQRSNSTNGKATAATTVSSRTVEETF
NLVPRESSSAFGMIIKLAPDLVEEIKRVEAQGGAAKIKFDAYPNNSTGNIINVGGKEFRFNWSRERGDLCDIYEEHQSGE
DGNGLLIEAGCAWRKLNVQRTLDESTTSHMKMRSVEAEQRTKSRKTIVLDPGNPSLTKQLAHAEGSPWRMSNKQKKEPPP
KKRKVDPPPVPVGGPKPSFRPGASTPTVKNRLSASPGPSPSNQFNTPPFGIGNIAKTHTANENVTPVQTKGREKMLEREP
STWKNNALRDTSGREATNVSKEIDLQSLLVDILKEAPMSLKALEKAVGDRIPNAAKKIEPILKKIANFQAPRYFLKPEAE
LESYKKHSPDNGSSPEHQQLLPITECSRDQLPVPGGNNMEKISLCEQNGEGSLDCLAVHLTEQLSTQENVDIEHHSPGLF
HEEKRSENSEGQARSSSDSDSDSDNSDSGSDSKSAAGSDSGSSSDSEASSNSKDGSDEDVDIMSDGDREPLLTIQSAEQG
AIDLPGHGSSAVEIEGHDSDAVDIDGHDSDAVDIDGHGSDAVDVEGNSSDEGHGSEADRKKLSGNSWKTETATGTSPPAN
EEVGISGQEHFASGHDNLRERQNFIGQLFDDTENTTKDNFKNDKRDISERLAKDQNQKTLDFEHYSQKSAREKNRKSQSC
NQLPAISKDSQRSELKYDAELRNASASQTIDPLRGLQKSSIEKSNRHGKSNKHSDALGNVRKPDEGDHFPHEMLSSRSGK
AFRDNQRDDVHLKNKFPRNKKDGESAIRPSLPTETSDRKHGELDGSDKDPKNVSGLSIGSSPLDSQRTYLAKSPKENGSV
LQKQVSELELGELPEPLGEDTALKPLEDKTSFRQSNLKPSTSEKSGIDTDKRRSKKSDSKKSAPPHAVNCIKELPEHIVE
DSERSQKWALQSHGQNLTGTDTEIGSQNKNLEDAAYKSRQKDSRARVGNSVEGYGETNKKTPVIKHGSKRASTSRSSRES
KRHASVSNSINGHKDATSIPGDSVVREKRMTSFGEEDSSYLKYEKASPELKGPISDHLQYKAYMQEYIDKYDSYCSINKI
LESHRNDFQKLGQDLGFAKGRDVERYNKIVEQIKESYCKYGEWHKRLKKVFVVLHEELKELKQRMRDYASSHGKD*

DNA
ATGTACAAAGGATCGTCGAAACGTGGCGGTAGAGGGGGAAACGGTGGTGGTAGCGGTGGACCGTCCCGTAACCGTAATTC
ATTCCCTCCTCCTACAAACCGACATCCTTCTCCCGTCGGGAGGATGTCTTCTGGTGGTGGTGGTGGTTCAGCCGCCGCTC
CACGCCAGCGGAGTAATTCTACTAACGGTAAGGCGACTGCGGCGACTACGGTGTCGTCACGGACGGTTGAGGAAACGTTT
AATCTTGTTCCGAGGGAGAGTTCTTCGGCTTTTGGAATGATTATAAAGTTAGCTCCTGATTTGGTGGAGGAGATCAAGCG
TGTGGAGGCACAAGGTGGAGCTGCGAAGATCAAGTTCGATGCGTATCCTAACAATAGCACTGGGAATATAATTAATGTTG
GTGGAAAGGAGTTCAGATTTAATTGGTCTAGGGAGCGTGGTGATTTATGTGATATATATGAAGAACATCAAAGTGGTGAA
GATGGAAATGGTTTGCTGATTGAGGCTGGATGTGCTTGGCGAAAATTGAACGTCCAGCGAACTCTAGATGAGTCAACCAC
AAGCCATATGAAGATGCGCTCAGTTGAAGCTGAACAGAGAACCAAATCACGCAAGACCATTGTTTTAGATCCTGGGAATC
CATCATTAACGAAGCAGTTAGCTCATGCTGAAGGAAGTCCATGGAGAATGTCAAATAAACAGAAGAAGGAACCTCCACCT
AAGAAGCGGAAAGTTGATCCACCTCCAGTTCCAGTCGGAGGTCCAAAGCCTTCTTTCAGACCAGGGGCTTCTACTCCTAC
TGTGAAAAATAGGCTATCAGCTTCACCGGGACCCTCTCCTAGTAATCAATTTAATACCCCTCCATTTGGGATTGGGAATA
TTGCTAAAACTCATACAGCTAACGAGAATGTCACACCAGTCCAGACAAAGGGCAGAGAGAAGATGCTTGAAAGAGAACCA
TCAACCTGGAAAAATAATGCATTAAGGGACACATCTGGGCGCGAAGCAACCAATGTTAGTAAAGAAATTGACTTGCAGTC
ACTGCTGGTTGATATCCTAAAAGAGGCTCCAATGAGCTTGAAGGCTTTAGAGAAAGCTGTTGGAGATAGAATCCCTAATG
CCGCAAAGAAGATTGAACCAATTTTGAAAAAAATCGCAAATTTCCAAGCTCCAAGGTATTTCTTAAAACCAGAAGCAGAG
TTGGAAAGCTATAAAAAACATTCACCTGATAACGGAAGTTCACCTGAACACCAACAATTGTTGCCGATCACTGAGTGCAG
TCGCGATCAGTTACCTGTTCCAGGGGGAAATAACATGGAGAAAATTTCTTTGTGCGAGCAGAACGGAGAAGGTTCACTAG
ACTGTTTAGCTGTGCATCTAACAGAGCAATTGAGTACGCAGGAAAATGTTGACATTGAGCATCATTCACCTGGTCTTTTT
CATGAGGAAAAACGATCCGAGAATAGTGAAGGCCAGGCTCGTAGCTCTAGTGATAGTGACAGTGATAGTGATAACAGTGA
CAGTGGGAGTGACAGTAAAAGTGCAGCTGGAAGTGACAGTGGGAGCAGCAGTGATAGTGAGGCTTCTTCTAACAGTAAGG
ACGGTTCTGATGAGGACGTGGATATCATGAGTGATGGTGACAGAGAGCCTCTACTGACAATACAGTCCGCTGAACAGGGT
GCAATTGATCTCCCAGGTCATGGTTCTAGTGCAGTTGAAATCGAGGGTCATGATTCTGATGCTGTTGACATTGACGGTCA
TGATTCTGATGCAGTTGATATTGATGGTCATGGGTCTGATGCAGTTGATGTCGAGGGGAACAGTTCAGATGAGGGTCATG
GTTCTGAAGCTGACAGAAAAAAACTCTCTGGTAATAGCTGGAAAACAGAAACAGCAACTGGTACCAGTCCCCCTGCAAAT
GAAGAAGTTGGCATTTCAGGGCAGGAACATTTTGCTTCTGGTCACGACAACCTACGAGAGCGCCAAAATTTTATTGGACA
GTTGTTTGATGACACAGAGAATACAACAAAGGATAACTTTAAAAATGACAAACGTGACATCTCCGAGAGGCTGGCAAAAG
ACCAGAACCAAAAAACCCTTGATTTTGAGCACTACAGTCAGAAATCAGCACGAGAGAAAAATAGAAAATCCCAGAGCTGC
AATCAGTTACCTGCCATAAGTAAAGATTCACAGCGTTCAGAGCTCAAGTATGATGCAGAACTTCGCAACGCTTCTGCGAG
TCAAACGATAGATCCACTTAGAGGACTCCAGAAGTCATCTATTGAAAAGTCGAATAGACATGGTAAATCAAACAAACATT
CTGATGCCTTGGGAAATGTTCGTAAACCTGACGAAGGGGACCATTTTCCGCATGAAATGCTTTCTAGTCGGTCAGGAAAG
GCCTTCAGGGACAATCAAAGAGATGATGTTCATTTGAAAAATAAATTTCCAAGGAATAAAAAAGATGGTGAGTCAGCCAT
TCGACCTTCGTTACCTACCGAGACATCCGATAGAAAGCACGGTGAACTGGATGGAAGTGACAAGGATCCCAAGAATGTTT
CAGGCTTGAGCATAGGTTCTTCTCCCTTAGATAGCCAGAGAACATATTTGGCGAAATCACCTAAGGAAAATGGATCTGTC
CTCCAAAAACAAGTTTCGGAATTGGAGTTGGGTGAACTCCCTGAGCCATTGGGTGAAGATACAGCATTGAAGCCACTCGA
AGATAAAACTTCGTTTAGGCAGTCAAATTTAAAACCAAGCACTTCAGAGAAATCGGGTATTGACACGGATAAACGAAGGT
CTAAAAAATCTGACTCAAAAAAGTCAGCTCCTCCACATGCAGTCAATTGTATCAAAGAATTGCCCGAACACATTGTTGAA
GATTCAGAAAGATCCCAAAAGTGGGCTTTGCAGTCACATGGGCAGAACCTTACTGGTACAGATACTGAAATCGGGTCACA
GAATAAAAATTTAGAGGACGCAGCTTATAAATCCAGACAAAAAGATAGTAGAGCAAGAGTAGGAAACAGTGTGGAAGGTT
ATGGAGAAACAAACAAAAAAACGCCTGTTATAAAGCATGGCTCCAAACGAGCGTCCACATCCCGCTCATCAAGGGAGAGC
AAAAGACATGCGTCTGTCTCAAATTCTATCAATGGACACAAAGATGCAACTTCAATACCAGGTGACAGTGTTGTCCGGGA
GAAACGAATGACATCTTTCGGTGAAGAAGACTCTTCTTATTTGAAATACGAGAAAGCTTCTCCTGAGCTGAAGGGACCCA
TTAGTGATCATTTGCAGTATAAAGCCTACATGCAGGAATATATTGATAAATATGATAGCTACTGCTCCATTAACAAGATA
TTAGAGAGCCACAGAAATGACTTTCAAAAGTTGGGGCAAGACCTTGGGTTTGCAAAAGGAAGGGATGTGGAGAGATATAA
CAAAATTGTGGAGCAGATAAAGGAATCTTATTGCAAATATGGGGAGTGGCACAAACGTTTGAAGAAAGTATTTGTTGTTC
TCCACGAAGAATTGAAGGAACTGAAACAAAGAATGAGAGACTATGCATCATCTCATGGAAAAGATTGA