Details for Lyrate rockcress Locus 16055953

Position : sca3 ( 5`- 7056078 .. 7051520 -3` )
Annotation : [B2G] atkinesin-13a kinesin-13a
External links : CoGe
PGDD synteny : 16055953

Protein [Map View]
MQQSNAAAATALYDGALPTNDAGDAVMARWLQSAGLQHLASPVASTGNDQRHLPNLLMQGYGAQTAEEKQRLFKLMRNLN
FNGESTSESYTPTAQTSAAMPSSEGFFSPDFRGDFGAGLLDLHAMDDTELLSEHMITEPFEPSPFMPSVNKEFEDDYNLP
ANRQQRQQTEAELVGLLPKSEKENNSVAKIKVVVRKRPLNKKETARKEEDVVTVSDNSLTVHEPKVKVDLTAYVEKHEFC
FDAVLDEDVSNDEVYRATIEPIIPIIFQRTKATCFAYGQTGSGKTFTMKPLPIRAVEDLMRLLRQPVYSNQRFKLWLSYF
EIYGGKLFDLLSERKKLCMREDGRQQVCIVGLQEYEVSDVQLVKDFIEKGNAERSTGSTGANEESSRSHAILQLVVKKHV
EVKDTRRRNNDGNELPGKVVGKISFIDLAGSERGADTTDNDRQTRIEGAEINKSLLALKECIRALDNDQLHIPFRGSKLT
EVLRDSFVGNSRTVMISCISPNAGSCEHTLNTLRYADRVKSLSKSGNSKKDQTANSMPPVNKDALLGPIDVEDVFEPPQE
VNVQETRRKVVEKDSNTTTSGIDFRQPTNYREESGIPSFSMDKGRSEMNTSFGGSTSQRNHMSSYPQETSDREEKVKKVS
PPRGKGLREEKPDRPQNWSKRDVSSSDIPTLTNFRQNKSETASRQYDTDPSLDENLDALLEEEEALIAAHRKEIEDTMEI
VREEMKLLAEVDQPGSMIENYVTQLSFVLSRKAAGLVSLQARLARFQHRLKEQEILSRKRVPR*

DNA
ATGCAGCAAAGCAATGCTGCGGCTGCGACGGCGCTATACGATGGGGCTTTACCCACAAATGACGCAGGGGATGCAGTCAT
GGCACGGTGGCTTCAATCCGCTGGATTGCAGCATTTGGCGTCTCCGGTTGCTTCTACGGGCAATGATCAGCGTCATCTCC
CAAACCTTCTCATGCAGGGTTATGGAGCACAGACTGCTGAAGAGAAACAAAGACTGTTCAAACTAATGAGAAATCTCAAT
TTTAATGGGGAGTCGACTTCTGAATCATATACTCCAACTGCTCAGACATCAGCAGCTATGCCCTCTTCGGAAGGATTTTT
TTCACCTGACTTCAGAGGTGATTTTGGAGCAGGATTATTGGATCTTCATGCAATGGATGATACAGAGCTTCTATCTGAGC
ATATGATTACCGAACCCTTTGAGCCGTCACCTTTCATGCCTAGTGTAAATAAAGAATTTGAAGACGACTATAATTTGCCA
GCTAATCGTCAACAACGTCAACAGACAGAAGCTGAACTTGTGGGTTTATTGCCTAAGAGTGAAAAAGAAAATAACAGTGT
AGCCAAGATTAAAGTAGTGGTAAGGAAAAGACCCCTAAACAAGAAAGAAACAGCTAGAAAGGAGGAGGATGTCGTGACGG
TATCTGATAATTCTTTGACTGTCCATGAGCCCAAAGTGAAGGTGGATTTGACTGCTTATGTGGAAAAGCATGAGTTCTGC
TTTGATGCTGTTCTAGATGAGGATGTCTCAAATGACGAGGTGTATCGGGCCACAATTGAGCCGATAATTCCAATTATTTT
CCAGAGAACTAAAGCTACATGCTTTGCATATGGTCAAACAGGTAGTGGTAAGACATTCACAATGAAACCACTACCCATAC
GAGCAGTTGAAGATCTTATGAGGTTGTTGCGTCAACCAGTATACAGCAATCAGAGGTTTAAATTGTGGCTCAGCTATTTT
GAGATATATGGTGGAAAGCTGTTCGATCTTCTCAGTGAGAGAAAGAAACTTTGCATGCGAGAAGATGGTAGACAGCAAGT
TTGCATTGTTGGCCTGCAAGAATATGAAGTTTCAGATGTACAACTTGTAAAGGATTTTATCGAGAAAGGAAATGCTGAAA
GGAGCACAGGGTCAACTGGAGCAAATGAGGAATCTTCTAGATCACATGCCATCCTACAGCTTGTTGTAAAAAAGCATGTT
GAGGTAAAAGATACTAGACGGAGGAATAATGATGGTAATGAATTGCCTGGGAAAGTTGTGGGAAAGATTTCTTTCATTGA
CCTTGCTGGCAGTGAAAGAGGTGCAGACACTACAGATAATGATCGCCAGACAAGGATTGAAGGCGCAGAAATCAACAAGA
GTCTCTTGGCTCTTAAGGAATGTATACGTGCACTGGACAATGACCAGCTACATATACCATTTCGTGGAAGCAAACTAACG
GAAGTGCTCCGTGACTCATTTGTTGGAAACTCAAGAACGGTGATGATTTCCTGCATCTCTCCAAATGCAGGATCGTGTGA
ACATACCCTCAATACTCTAAGATATGCTGATCGAGTCAAAAGTCTATCAAAAAGTGGAAATAGCAAGAAAGATCAAACTG
CCAATTCAATGCCTCCGGTTAATAAGGATGCTTTGTTAGGCCCAATTGATGTAGAAGATGTCTTTGAGCCTCCACAGGAA
GTGAATGTACAGGAAACCAGGAGGAAGGTGGTCGAGAAGGACAGCAACACTACTACATCGGGTATTGACTTCAGACAGCC
GACAAATTATCGAGAGGAAAGTGGAATCCCATCATTCTCAATGGATAAGGGCAGATCAGAGATGAATACTTCTTTCGGTG
GATCCACTAGCCAGAGGAACCACATGTCTTCATATCCCCAAGAAACCTCAGACCGTGAAGAGAAAGTGAAGAAAGTGTCA
CCACCTCGTGGGAAAGGGTTGCGGGAAGAAAAACCAGACAGACCACAAAATTGGTCTAAAAGAGATGTCAGTTCGTCGGA
TATCCCTACCTTGACAAATTTTAGACAGAACAAAAGTGAAACTGCTTCAAGGCAATATGACACCGACCCTTCGCTTGATG
AAAACCTCGATGCACTGCTTGAGGAAGAAGAAGCTCTGATTGCAGCACACAGAAAAGAAATTGAGGATACAATGGAGATT
GTTCGCGAGGAAATGAAACTTCTAGCGGAGGTGGACCAACCAGGAAGCATGATAGAAAACTATGTGACGCAACTGAGCTT
TGTGCTCTCCCGGAAAGCAGCAGGGCTAGTCAGTCTTCAAGCCAGGCTTGCTCGGTTCCAACATCGTCTCAAGGAACAAG
AAATACTGAGCCGTAAGAGAGTTCCTCGGTAG