Details for Lyrate rockcress Locus 16055935

Position : sca3 ( 5`- 10856665 .. 10858472 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055935

Protein [Map View]
MEIRTPKTGKAKRVLENRAPKLVETGKKTLILHGTKTSATLSSVLMELYRLKKGGAIRYSRRNENIRPFESGGETSLEFF
SQKTDCSIFVYGSHTKKRPDNLVLGRMYDHQVYDLIEVGIENFKTLLAFSYDKKFAPHEGSKPFICFTGEGFENVPELKH
LKEVLTDLFRGEVVDNLNLTGLDRAYVCSAISPTKVFLTHCALKLKKSGSIVPRMELVEVGPSMDLVIRRNRLPNESLMK
EAMRTSKDKPKKKVKNVDQDAVLGKTGKIYMPDQKLGDMKLLDKSKGLKRERKEAKLKHKEETVSKKMKESSE*

DNA
ATGGAAATACGAACTCCGAAGACTGGCAAAGCCAAACGTGTACTCGAAAACCGAGCTCCTAAGTTGGTTGAAACTGGGAA
GAAGACATTGATACTTCATGGAACAAAGACGAGTGCTACACTTAGCTCTGTGTTGATGGAACTGTACCGTTTGAAGAAGG
GAGGTGCCATTAGATATTCAAGAAGGAATGAGAATATTAGGCCTTTTGAGAGTGGTGGTGAAACTTCATTAGAGTTCTTC
TCTCAGAAAACTGATTGTAGCATTTTTGTGTATGGTTCTCACACGAAGAAACGACCTGACAATCTTGTACTTGGGAGAAT
GTATGATCACCAGGTCTATGATCTTATAGAAGTTGGGATTGAGAACTTTAAAACCTTGCTGGCGTTTTCGTATGACAAGA
AATTTGCACCTCATGAAGGATCAAAGCCTTTCATTTGCTTTACTGGAGAAGGTTTTGAGAATGTACCAGAGCTTAAGCAT
CTAAAAGAAGTCCTCACTGATCTGTTTCGTGGCGAGGTTGTGGATAATCTAAATCTTACTGGACTAGACCGAGCTTACGT
ATGTTCGGCTATATCCCCAACTAAGGTTTTCCTTACTCATTGCGCATTGAAGCTTAAAAAGTCAGGCTCCATTGTTCCTA
GAATGGAGCTTGTTGAAGTCGGTCCATCCATGGACTTGGTTATCAGGCGTAATCGTCTTCCTAACGAAAGCTTAATGAAA
GAAGCAATGAGAACATCCAAGGATAAGCCTAAGAAGAAGGTGAAAAACGTTGATCAAGATGCAGTACTAGGGAAGACTGG
GAAGATTTACATGCCTGATCAGAAGCTGGGCGATATGAAATTACTCGATAAATCCAAGGGATTGAAGAGAGAGCGGAAAG
AGGCTAAGCTTAAGCATAAGGAAGAGACTGTTTCCAAAAAGATGAAAGAGTCTTCTGAGTGA