Details for Lyrate rockcress Locus 16055931

Position : sca3 ( 5`- 9166253 .. 9163793 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055931

Protein [Map View]
MANLPSSLSMGTPFGGPSTSAQNPSGAPANKDRNLASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIA
ALLQEIVSIYSVLAPPNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIG
ALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTTAERFFAVGRVLGNMVQSLVEQP
SPRLLKHIIRCYLRLSDNPRACAALASCLPDSLRDGTFSNCLREDPTARRWLQQLVHNVGVGRVPTHQGGGFEHML*

DNA
ATGGCGAATCTACCTTCATCTCTCTCCATGGGCACACCTTTCGGTGGACCTAGCACCTCCGCACAAAATCCTTCCGGAGC
TCCGGCCAACAAAGATCGGAATTTGGCCTCTGCTGAGCAGTTGGTACTCGATCTCAGCAATCCTGAACTCAGAGAGAATG
CTCTTCTCGAGCTTTCCAAGAAAAGAGAATTGTTTCAGGATCTGGCGCCTCTGTTGTGGAACTCTTTTGGTACAATTGCT
GCTTTGTTGCAGGAGATAGTATCAATCTACTCTGTTCTTGCACCTCCAAATCTGACTCCTGCTCAGTCCAACCGTGTTTG
CAACTCGCTCGCACTTCTTCAGTGCGTAGCATCTCATTCTGACACAAGAATGTTATTTCTCAAGGCTCATATCCCATTGT
ACCTTTATCCCTTCCTTAATACAACGAGTAAGTCAAGACCTTTCGAATACTTGCGGCTTACTAGCTTAGGTGTCATTGGT
GCACTTGTCAAGGTTGATGATACAGAGGTCATTAGCTTCCTACTTTCAACTGAAATTATTCCGCTGTGCCTCCGTACCAT
GGAAATGGGGAGTGAGCTGTCAAAAACAGTGGCAACATTTATTGTTCAAAAGATATTGTTGGATGATGTGGGGATGGATT
ACATCTGCACAACAGCAGAGCGGTTTTTTGCAGTTGGTCGAGTGTTGGGCAACATGGTTCAGTCACTTGTGGAGCAGCCT
TCTCCGCGGCTTTTGAAGCATATCATTCGTTGCTATCTCCGTCTATCAGACAACCCAAGAGCTTGTGCTGCACTCGCAAG
CTGTCTCCCTGACTCGCTACGAGATGGAACCTTTAGCAATTGTCTTCGCGAGGATCCAACTGCAAGGAGGTGGCTGCAAC
AGTTGGTTCATAATGTTGGAGTTGGTCGAGTCCCAACACATCAAGGTGGAGGATTTGAGCACATGCTTTGA