Details for Lyrate rockcress Locus 16055898

Position : sca2 ( 5`- 16492965 .. 16491609 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055898

Protein [Map View]
MSSSAEFWDLSVRKPSFSQTCSRLSRYLKEKGSFGDLTLGMTCKPDLNGGVAVSRQPTMMNLFPCEASGMDSSAAQDIKP
KNVFPRQSSFSSSSCSSGAKEDVHMIKETKSVKPESQSAPLTIFYAGRVMVFDDFSAEKAKQVIDLANKGSSKGFTAEVN
NSQSAYSQHLAKTQKEIASSPNPVYSPAKTAAQESIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEA
SSKPNPAWLSSR*

DNA
ATGTCGAGTTCTGCCGAGTTTTGGGACTTGTCTGTTCGGAAGCCGAGCTTTTCACAGACATGTAGTCGATTAAGTCGTTA
TCTGAAGGAGAAGGGTAGTTTTGGAGATCTGACCTTAGGGATGACATGCAAGCCTGACCTCAATGGAGGTGTTGCTGTTT
CACGTCAGCCTACAATGATGAATCTGTTCCCTTGTGAAGCTTCAGGAATGGATTCTTCTGCTGCTCAAGACATTAAACCG
AAGAATGTGTTTCCCAGACAATCAAGCTTTTCTTCTTCTTCTTGCTCCTCTGGGGCCAAAGAAGATGTCCACATGATCAA
AGAGACTAAATCTGTGAAGCCAGAGTCTCAATCTGCTCCGTTGACCATATTCTACGCTGGTCGAGTTATGGTCTTTGATG
ATTTTTCTGCTGAGAAAGCCAAACAAGTTATTGATTTGGCTAACAAAGGAAGTTCCAAAGGTTTCACAGCTGAAGTGAAC
AATAGCCAGAGTGCTTATTCTCAACACTTGGCCAAGACTCAAAAAGAGATTGCTTCTAGCCCGAATCCAGTATATAGTCC
TGCGAAAACCGCAGCACAAGAGTCAATCCAGCCCAACCCGGCCTCTTTAGCCTGCGAACTCCCGATTGCCAGAAGAGCTT
CGCTTCATCGATTCCTAGAGAAGAGGAAGGATAGGATCACATCAAAGGCACCATACCAAATAGACGGTTCAGCTGAAGCG
TCTTCAAAGCCTAACCCAGCTTGGCTCAGTTCGCGGTAA