Details for Lyrate rockcress Locus 16055893

Position : sca3 ( 5`- 3040177 .. 3038060 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896879 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055893

Protein [Map View]
MGVILDSWCFCKGVGKSEKMKASIFSGKAPAMARISVSGPNGVTSGTGFLIHRNLLLTTHLNLPSISATETAEVRLQNGV
AAALFPHRFFITSSVIDLTIVGLDLVDGDSNSQSQTQQPHYLKTCSKPNLDLGSVVYLLGYANQNELKIGEGKLVVATDN
LIKLSTDEMIWSPGSAGFDVQGNLAFMICDPRKLSTSPTSTSTSSSSSLKKDNNKPLMMQFGIPIPVICDWLNQHWEGSL
DEHSSKPKLPLIRLMSSGQKSERSCTSFTMRRVFKPNDSADVGTPSSSNTRDQTHPSSSIAAEEEKEEETSKTNPQGGGT
TTHAQGIPTPEIYESPKLTSGPLRNETGQVHLLDINFPPRIPKATTFLPELNSLQGNHVVEEAEIVSEGSDAQIASTGSV
NGDLSEVISSSPPAAAHYVYNNHGYSSEEETMYSAETAESRNYPTPPRKSEFHHERVGRSQSCVSSSRWGTPQKSSNGRR
EMLEKQRSFVHGKKMHSQGAMSQRSNDYYSPTVSSIMKKRNNSSEQQIFKPVPRPRAISSSPRWAF*

DNA
ATGGGAGTGATATTGGACTCATGGTGCTTTTGTAAAGGAGTAGGCAAAAGCGAGAAGATGAAAGCTTCCATTTTTTCCGG
CAAAGCTCCGGCGATGGCTCGAATCTCTGTCTCCGGACCAAATGGTGTTACTTCCGGTACGGGATTCCTTATTCACCGGA
ATCTTCTTCTGACCACTCACCTCAATCTCCCTTCCATCTCCGCCACCGAAACCGCCGAGGTCCGCCTCCAGAACGGCGTC
GCCGCCGCTCTCTTCCCTCACAGGTTTTTCATTACAAGTTCGGTTATTGATCTCACTATTGTTGGCTTAGACCTTGTTGA
TGGAGACTCAAATTCCCAGAGCCAAACCCAACAGCCACATTACCTGAAGACATGTTCCAAACCAAACCTGGATCTAGGGA
GTGTGGTGTACCTCTTAGGCTATGCCAATCAGAATGAACTCAAGATCGGTGAGGGAAAGTTAGTTGTAGCTACCGACAAT
CTCATCAAGCTCTCGACTGATGAAATGATTTGGAGTCCTGGATCTGCTGGATTTGATGTTCAAGGGAATCTCGCATTCAT
GATCTGTGATCCGAGGAAACTATCGACATCACCAACCTCAACCTCGACATCTTCCTCTTCGTCTTTGAAGAAAGATAACA
ACAAGCCACTGATGATGCAGTTTGGTATACCAATACCAGTAATCTGTGACTGGCTGAATCAGCATTGGGAAGGTAGTTTG
GATGAACATTCTTCAAAGCCCAAGTTGCCTCTTATTCGGTTAATGTCTTCTGGTCAGAAGAGTGAGCGTTCTTGTACTTC
ATTCACCATGCGCCGTGTTTTCAAGCCAAACGACTCTGCTGATGTTGGAACACCATCTTCATCTAACACTAGAGATCAAA
CTCATCCGAGCTCTTCTATAGCTGCTGAGGAAGAAAAAGAAGAAGAAACCTCAAAAACCAATCCACAAGGTGGCGGAACT
ACTACTCATGCACAGGGTATCCCGACCCCTGAGATATATGAATCGCCAAAGTTGACTTCTGGTCCTTTAAGAAATGAGAC
TGGTCAAGTACACCTTTTGGACATCAACTTTCCTCCACGGATACCTAAAGCTACAACCTTTCTTCCTGAGCTCAACTCTC
TACAGGGTAACCACGTAGTGGAAGAGGCTGAGATTGTCTCTGAGGGATCAGATGCGCAGATTGCTTCGACAGGTTCAGTA
AACGGTGATCTCAGTGAGGTCATCTCAAGTTCACCACCAGCCGCAGCTCACTATGTATATAACAATCATGGATACAGCAG
CGAGGAAGAGACGATGTATTCTGCAGAAACAGCAGAAAGCCGAAACTACCCAACTCCTCCAAGAAAAAGCGAGTTTCATC
ATGAGAGAGTTGGAAGGAGCCAAAGCTGTGTGAGCTCCAGCAGATGGGGAACTCCTCAGAAGAGTTCGAATGGTAGAAGA
GAAATGCTGGAGAAACAGAGAAGCTTCGTCCATGGAAAGAAGATGCATTCACAAGGAGCAATGTCACAGAGGAGTAATGA
CTATTACAGCCCAACTGTCTCATCCATCATGAAGAAAAGGAACAATAGTTCAGAGCAACAGATTTTCAAACCGGTACCTA
GACCTAGAGCTATTAGTTCTTCACCAAGATGGGCGTTCTGA