Details for Lyrate rockcress Locus 16055885

Position : sca3 ( 5`- 2737143 .. 2734511 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896791 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055885

Protein [Map View]
MAKPEEVSVPIFSSLEPVYGEGSLLQEATQRFDVLKANFNHVFGASPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDT
IIAIRKCEDQKQLRIANVNHKYTMCTYPADPDQEIDLKNHKWGHYFICAYKGFHEYAKSKGVNLGSPVGLDVLVDGIVPT
GSGLSSSAAFVCSATIAIMAVFGHNFDKKELAQLTCECERHIGTQSGGMDQAISIMAKTGFAELIDFNPVRATDVKLPDG
GSFVIAHSLAESQKAVTAAKNYNNRVVECRLASIILGVKLGMEPKEAISKVKTLSDVEGLCVSFAGDRGSSDPLLAVKEY
LKEEPYTAEEIEKILEEKLPSILNNDPTSLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVDSNLSDEEKLKKLGDLMN
ESHYSCSVLYECSCPELEELVQVCKDNGALGARLTGAGWGGCAVALVKESGVTQFIAAVEEKYYKKRVEKGVVKEEDMEL
YLFASKPSSGAAIFNL*

DNA
ATGGCGAAACCAGAAGAAGTATCGGTCCCGATCTTCTCGTCCCTTGAGCCTGTCTACGGCGAAGGATCTCTGCTCCAAGA
AGCTACGCAACGATTCGATGTTTTGAAGGCCAATTTCAACCATGTCTTCGGTGCTTCACCCCAACTCTTCGCTCGCTCTC
CTGGAAGAGTGAATCTGATAGGAGAGCACATTGACTACGAAGGATACTCAGTGTTGCCAATGGCTATTCGTCAGGATACA
ATTATAGCGATTCGGAAATGTGAGGATCAAAAGCAGCTTCGGATTGCTAATGTTAATCATAAGTACACTATGTGTACATA
TCCTGCTGATCCTGACCAGGAAATTGACTTGAAGAATCACAAATGGGGCCATTACTTCATATGCGCGTACAAAGGATTCC
ATGAATATGCAAAGTCAAAAGGTGTGAATCTTGGTTCACCAGTTGGTCTTGATGTGCTTGTTGATGGAATTGTTCCTACA
GGTTCTGGGTTGTCAAGTTCTGCTGCCTTTGTTTGCTCAGCAACAATTGCTATTATGGCTGTCTTTGGTCATAACTTTGA
CAAGAAAGAACTTGCACAGCTTACATGTGAATGTGAACGACACATTGGAACACAATCTGGTGGGATGGACCAGGCAATCT
CTATTATGGCTAAAACTGGATTTGCTGAGCTTATTGACTTCAACCCAGTCCGCGCAACTGATGTGAAACTTCCTGATGGA
GGGAGTTTTGTAATTGCACATTCTCTTGCAGAGTCGCAGAAGGCGGTCACGGCTGCTAAGAATTACAATAACAGGGTCGT
TGAATGTCGACTTGCTTCGATCATTCTTGGTGTGAAGCTCGGAATGGAACCAAAAGAAGCAATATCAAAAGTTAAGACTC
TTTCTGATGTGGAGGGATTATGTGTGTCATTCGCTGGTGATCGTGGGTCATCTGATCCTCTTCTTGCTGTTAAGGAATAT
CTGAAAGAAGAACCATACACCGCTGAGGAGATTGAGAAAATCCTGGAGGAGAAATTACCATCAATCTTGAACAATGATCC
AACATCTTTGGCTGTACTCAATGCTGCCACGCATTTCAAATTGCATCAGAGAGCTGCACATGTTTATTCCGAAGCCCGGA
GGGTTCATGGTTTCAAGGACACAGTTGATTCAAACTTAAGTGACGAAGAGAAGTTAAAGAAACTTGGTGATCTCATGAAT
GAAAGCCATTACAGCTGCAGTGTCCTATATGAGTGCAGTTGTCCCGAGCTAGAAGAACTGGTTCAAGTTTGCAAGGATAA
TGGAGCACTTGGAGCAAGACTGACCGGAGCTGGATGGGGCGGTTGCGCCGTGGCCTTGGTTAAGGAATCTGGCGTTACTC
AATTCATCGCAGCAGTCGAGGAGAAATACTACAAAAAGAGAGTAGAGAAAGGAGTGGTAAAGGAAGAAGATATGGAGCTT
TACCTTTTTGCCTCCAAGCCTTCAAGTGGTGCTGCCATCTTCAACCTCTAA