Details for Lyrate rockcress Locus 16055883

Position : sca3 ( 5`- 3788213 .. 3784577 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055883

Protein [Map View]
MTTLVGRVGNLISQGVYSVATPFHPFGGAIDVIVVQQQDGSFRSTPWYVRFGKFQGVLKGAEKFVKISVNGTEADFHMYL
DNSGEAYFIREVDPANNDTNSLISGSENNNGNVGYRLEHSLSDSGAGELREGFESLNRLERTESDCNRRFYDFQDDPPSP
TSEYGSARFDNLNVESYGDSQGSDSEVVLVSIDGHILTAPVSAAEQEAENLRLNTPQFHLAPGDGTEFCEGNTEFASSET
PWDTEYIAKVEESSDTANIVSEILDTTNDERNDLDSHDNAEKDSHDAERDILGSCLEQSETGENAKSGEPGSTFEDLNLK
EGDFPLSTITENDRSEDEVTIETVDTLVDSFESSTTPVTAEEMKTTEESRISVDFNADSECKDEQPRTSAETAILINNQE
GGIIESEDQNSERVSIDSTREEVEQLTPSKPTDKDNENGTTVVSVDATSSVDLGKPDTVQRYELSLCKDELRQGMGLSAA
AEVFDAHRISMEEYINSATSILESENLVVRIRETYMPWTKAARIVLGKAVFDLDLDIQPDDVISVEENESPKPKDDETTI
TPSSSGRRWTLWPIPFRRVKTVEHTGSNSSSEEDLFVDSEPGLQNSPETQSTTESRHESPRRQLVRTNVPTNEQIASLNL
KDGQNMITFSFSTRVLGTQQVDAHIYRWRWDTKIVISDVDGTITKSDVLGQFMPFIGKDWTQSGVAKLFSAIKENGYQLL
FLSARAIVQAYLTRSFLNNLKQDGKALPNGPVVISPDGLFPALYREVIRRAPHEFKIACLEDIRKLFPTDYNPFYAGFGN
RDTDELSYRKLGIPKGKIFIINPKGEVATGHRIDVKKSYTSLHTLVNDMFPPTSLVEQEDYNPWNFWKLPIEEVD*

DNA
ATGACGACTTTGGTTGGAAGAGTTGGGAATTTGATTTCTCAAGGCGTTTACTCTGTCGCTACACCATTTCATCCATTTGG
TGGTGCTATTGATGTCATCGTTGTTCAACAACAAGATGGTTCTTTCCGTAGCACGCCTTGGTATGTTAGGTTTGGTAAGT
TCCAAGGTGTTCTCAAAGGCGCTGAGAAGTTTGTCAAGATATCTGTAAATGGTACCGAAGCCGATTTCCACATGTATCTT
GATAATTCTGGTGAAGCATACTTCATCAGGGAAGTTGATCCTGCTAATAATGACACCAACAGTTTGATTTCCGGGTCTGA
GAATAACAATGGTAACGTGGGTTATCGACTTGAGCACAGTTTATCGGACTCTGGTGCTGGAGAACTACGAGAGGGTTTCG
AATCTTTGAATCGGCTTGAGAGGACAGAGTCTGATTGTAATAGGAGGTTTTATGATTTTCAGGATGATCCGCCTTCTCCA
ACCTCAGAATACGGAAGTGCTCGATTTGACAATCTAAATGTGGAAAGTTATGGGGATTCTCAAGGCTCAGATTCTGAAGT
GGTTTTGGTCAGTATTGATGGACATATACTAACAGCTCCTGTGTCAGCGGCAGAGCAGGAGGCTGAGAATTTGCGGTTAA
ATACTCCTCAGTTTCATTTGGCCCCTGGTGATGGGACTGAGTTTTGTGAAGGTAATACTGAGTTTGCTTCGTCAGAGACT
CCGTGGGATACTGAATATATCGCCAAAGTGGAGGAGTCATCTGATACTGCTAATATCGTATCTGAAATATTAGATACCAC
GAATGATGAGCGTAATGATTTAGATTCCCATGATAATGCCGAAAAAGATTCTCATGATGCTGAAAGAGATATTCTTGGGA
GCTGTCTGGAGCAGTCAGAGACTGGTGAGAATGCCAAGTCCGGGGAACCAGGTTCTACTTTTGAGGATCTGAATCTAAAA
GAAGGTGACTTTCCACTTAGCACCATCACGGAAAATGATAGAAGTGAAGATGAAGTGACTATTGAAACAGTAGATACTCT
TGTTGATAGTTTTGAATCTTCTACAACCCCAGTAACAGCAGAAGAAATGAAAACAACTGAGGAATCCAGAATATCCGTCG
ATTTTAATGCTGATTCAGAATGTAAGGATGAACAGCCAAGAACATCTGCAGAAACTGCCATCTTGATTAACAACCAGGAA
GGCGGGATTATAGAATCGGAAGATCAGAATTCTGAGAGAGTCTCTATAGATTCAACGAGGGAAGAAGTTGAGCAACTGAC
TCCATCTAAACCAACTGATAAGGATAACGAGAATGGTACGACTGTAGTTTCAGTGGATGCGACTTCTAGTGTCGACTTAG
GAAAACCCGATACAGTTCAGAGATATGAGCTATCACTTTGCAAGGATGAGCTTCGTCAGGGTATGGGACTTAGCGCAGCT
GCTGAAGTCTTTGATGCGCATCGGATCTCCATGGAAGAATATATAAATTCGGCAACATCAATTCTTGAAAGTGAAAATCT
GGTTGTTAGGATTAGAGAAACGTATATGCCATGGACGAAAGCTGCTCGGATTGTTCTTGGGAAAGCTGTGTTTGATCTAG
ACTTAGATATCCAGCCAGATGATGTGATTTCTGTGGAGGAAAATGAATCGCCTAAACCCAAGGATGATGAAACTACAATA
ACTCCTTCTTCATCTGGAAGAAGATGGACACTCTGGCCGATTCCTTTTCGAAGGGTTAAAACAGTTGAGCATACAGGAAG
TAACTCCTCAAGCGAAGAAGATCTGTTTGTTGATTCTGAACCTGGCTTACAGAACTCACCGGAAACACAATCAACCACAG
AGAGTCGCCATGAGTCTCCGCGTAGACAACTTGTGAGAACTAATGTCCCTACCAATGAACAAATCGCATCTCTGAATCTG
AAAGATGGTCAGAATATGATAACTTTTAGTTTCTCAACAAGAGTTCTTGGAACACAGCAGGTCGATGCACATATTTACCG
GTGGAGATGGGACACCAAGATAGTGATCTCAGATGTTGATGGAACTATAACTAAATCTGATGTGTTAGGTCAGTTCATGC
CCTTCATTGGAAAGGACTGGACACAATCCGGTGTAGCTAAGCTTTTTTCTGCCATAAAGGAGAATGGATATCAGTTGCTG
TTTTTGAGCGCTCGTGCCATCGTTCAGGCATATCTAACGAGAAGTTTCTTAAATAATCTGAAGCAAGACGGAAAAGCTCT
GCCAAATGGCCCTGTGGTCATTTCTCCAGATGGCCTATTTCCAGCATTGTACCGTGAAGTGATAAGAAGAGCACCTCATG
AATTCAAGATCGCATGTTTGGAGGATATCAGGAAACTTTTCCCAACAGATTACAACCCGTTCTACGCTGGATTTGGAAAC
AGAGACACAGATGAGCTGAGTTACAGAAAACTCGGAATCCCAAAGGGAAAGATATTCATAATCAACCCAAAGGGAGAAGT
GGCAACAGGACATCGCATAGATGTCAAGAAGTCTTACACTTCACTTCATACTCTTGTCAACGACATGTTTCCTCCAACTT
CACTTGTTGAGCAGGAAGATTATAACCCATGGAACTTCTGGAAACTACCGATAGAAGAGGTTGATTGA