Details for Lyrate rockcress Locus 16055841

Position : sca3 ( 5`- 460446 .. 462811 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055841

Protein [Map View]
MESQQSNLETPLKIQPDHQEITTLNPLSPPQPLPESCRNHDSPPPRASTNEPMKKIGTPDRLRVPIAFKHPERYRSPTDA
MMSPVTKGLLARTRKASGSLIPPSFNQTKIQELRKPESETENKEHQWKHSMSSRSSSRSSSITSASSDGHFDIRHFPLPK
PSLSASEAQKLRESHQAYNSSVSSYTSSSWSSNHQNHLVDLPGYDPSRIPSSVFSSKPGNSTEWSLASNESLFSIHDGNF
SISTALRLAEIPKFEETVHEITEINTVPLPPPLPPGKKPNESEKETISEEEPYQVENLDSEIDNNEEGEEKMSEVESDDE
HEDMIEAEVLVEKEVIETVKENKPEDSNSIVSHSPSISCRSDTSNNSIGSFAFPLLQKEDAVIKTPSVQIKGNLSHKRKP
EYQLPQSRMLLPQQQLQPYSESSMLTESESESIQQRKASKKFESPTQSLKASRTCWFSCFHCPSKCSIFK*

DNA
ATGGAGTCGCAACAATCGAATCTTGAAACACCTCTCAAAATCCAACCCGACCACCAAGAAATCACTACTTTGAACCCTCT
ATCGCCACCACAACCGCTCCCGGAATCCTGCCGGAATCATGATTCTCCTCCTCCTCGAGCCTCAACCAACGAGCCGATGA
AGAAAATCGGAACTCCGGATCGTTTAAGAGTCCCTATAGCTTTCAAGCACCCAGAGAGGTACAGAAGCCCAACTGATGCA
ATGATGTCTCCAGTAACTAAAGGTCTTCTCGCAAGGACCAGAAAAGCTTCTGGTTCTCTTATTCCACCCAGCTTTAACCA
AACCAAGATTCAAGAACTACGCAAACCGGAATCCGAAACTGAAAATAAAGAACATCAATGGAAGCATTCGATGTCTTCAA
GGTCATCTTCACGATCTTCATCGATAACATCTGCTTCTTCGGATGGCCACTTTGATATCCGACACTTTCCTCTTCCTAAG
CCATCATTGTCTGCTTCTGAGGCACAGAAACTGAGAGAGTCACATCAGGCTTATAATTCATCTGTTAGCTCTTATACCAG
TTCGTCTTGGTCCTCAAATCACCAGAACCACCTTGTTGATTTACCCGGTTACGATCCATCCCGAATTCCATCTTCAGTTT
TCTCTAGTAAACCGGGTAATTCGACTGAATGGAGTCTAGCTTCTAATGAATCTTTGTTTAGCATCCACGATGGGAATTTT
AGCATTTCAACAGCATTAAGATTGGCTGAGATACCAAAATTTGAAGAAACTGTTCACGAGATAACCGAAATCAACACGGT
TCCTCTTCCTCCTCCTTTACCTCCGGGTAAAAAACCAAATGAATCTGAGAAAGAGACGATTTCAGAGGAGGAACCATACC
AGGTGGAGAATTTAGACTCTGAGATTGACAATAATGAAGAAGGAGAAGAGAAGATGAGTGAAGTCGAGAGCGACGATGAA
CATGAAGATATGATCGAAGCGGAGGTTTTAGTAGAGAAAGAAGTAATAGAAACTGTGAAGGAGAATAAACCAGAAGACTC
GAACAGTATAGTTTCACATTCCCCGAGCATTTCTTGTCGTTCGGACACCAGCAATAACAGCATTGGTTCTTTCGCATTCC
CACTATTGCAAAAAGAAGATGCAGTTATTAAAACGCCGTCTGTGCAAATCAAAGGAAACCTTTCCCACAAGCGAAAACCT
GAGTATCAGCTGCCTCAATCGCGAATGCTACTGCCACAACAGCAACTGCAACCTTATTCAGAATCTAGTATGCTAACTGA
ATCTGAGTCGGAATCAATCCAACAAAGGAAGGCATCGAAAAAATTCGAATCTCCAACGCAATCGCTAAAAGCTTCAAGAA
CATGCTGGTTCTCTTGCTTCCATTGTCCTTCAAAATGCAGTATATTCAAGTAG