Details for Lyrate rockcress Locus 16055832

Position : sca3 ( 5`- 22172617 .. 22173879 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_900110 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055832

Protein [Map View]
MAASTNSFLIGNQTQIPSLKPKSISQSFIHFTKPNTINLTTRTTSISIRCASTTVGSEQRVFNFAAGPAALPENVLLKAQ
SDLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLEIPSEYSVLFLQGGATTQFAALPLNLCKSDDSVDYIVTGSWG
DKAFKEAKKYCNPKVIWSGKSEKYTKVPSFDGLEQTSHAKYLHICANETIHGVEFKDYPVVKNPDGILIADMSSNFCSKP
VDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIHDENSSLYNTPPCFGIYMCGLVFDDLLEQGGLK
EVEKKNQRKAMLLYNAIDESRGFFRCPVEKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAM
PLAGVEKLVAFMKDFQARHA*

DNA
ATGGCGGCATCGACGAACTCATTCCTCATCGGAAACCAAACACAAATCCCTTCCCTGAAACCCAAATCAATTTCCCAATC
CTTCATCCACTTCACCAAACCTAACACCATCAACCTCACCACCAGAACCACATCCATTTCAATTCGATGCGCTTCAACCA
CCGTCGGATCCGAGCAACGAGTCTTCAATTTCGCCGCCGGTCCAGCCGCATTACCGGAAAACGTCCTCCTTAAAGCTCAA
TCAGATCTCTATAACTGGCGTGGATCTGGTATGAGTGTCATGGAGATGAGTCACCGTGGTAAAGAGTTTCTCTCAATCAT
TCAAAAAGCTGAATCTGATCTCCGTCAGCTTCTCGAGATTCCATCGGAATATTCCGTTTTGTTCTTACAAGGCGGTGCCA
CTACTCAATTCGCTGCTTTACCTCTAAATCTCTGCAAATCTGATGATTCCGTTGATTACATTGTTACTGGATCTTGGGGA
GATAAAGCTTTTAAGGAAGCGAAGAAATATTGTAACCCTAAAGTTATTTGGTCTGGTAAATCTGAGAAATATACTAAAGT
TCCATCTTTTGATGGATTGGAGCAGACTTCGCACGCCAAGTATTTGCATATATGCGCCAATGAGACTATTCATGGAGTTG
AATTTAAAGATTATCCTGTTGTTAAAAACCCTGATGGTATTCTTATTGCTGATATGTCTTCCAATTTCTGTTCGAAGCCG
GTGGATGTATCGAAATTCGGTGTGATTTACGCGGGTGCGCAGAAGAATGTTGGTCCTTCTGGTGTCACCATTGTGATAAT
TCGAAAGGATTTGATTGGGAATGCTCGTGATATAACTCCGGTGATGCTTGATTACAAGATTCATGATGAGAACAGCTCGT
TGTATAACACGCCACCGTGTTTCGGGATTTACATGTGTGGTCTTGTGTTTGATGATTTGTTGGAGCAAGGTGGGTTGAAG
GAAGTGGAGAAGAAGAATCAGAGGAAAGCTATGTTGTTGTACAATGCAATTGATGAGAGTAGAGGTTTTTTCAGGTGTCC
TGTTGAGAAATCTGTGAGGTCTTTGATGAATGTTCCTTTTACGTTGGAGAAATCGGAATTGGAAGCTGAGTTTATTAAAG
AAGCTGCTAAGGAGAAGATGGTGCAGCTTAAGGGACATAGATCAGTGGGAGGTATGAGAGCTTCTATTTACAATGCAATG
CCGTTGGCCGGTGTCGAGAAGCTAGTTGCTTTCATGAAAGATTTTCAGGCAAGGCATGCTTGA