Details for Lyrate rockcress Locus 16055821

Position : sca3 ( 5`- 3084337 .. 3082635 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055821

Protein [Map View]
MDSSCLSNQTALQFLPSRSRRQSGDGGGGGFVIPAKRKIQYSSMVVVAAAGPSRCEPGSSLNAPLEPRSAQGRFLRSVLL
NKRQLFHYAAADELKQLADDREAALARMSLSSGSDEASLHRRIAQLKERYCKTAVQDIMYMLIFYKYSEIRVPLVPKLSR
CIYNGRLEIWPSKDWELESIHSCDTLEIIKEHVSAVIGLRVNSCVTDNWATTQIQKLHLRKVYAASILYGYFLKSASLRH
QLECSLSDLHGSGYLKSPILGCSFTTSTAQISSKQQLRHYISGFDPETLQRCAKPRTEEARNLIEKQSLALFGTEESDET
IVTSFSSLKRLVLEAVAFGTFLWDTELYVDGAYKLKENNGNAEEQEGKRSI*

DNA
ATGGATAGTAGTTGTCTCTCTAATCAAACGGCACTTCAGTTTCTCCCGTCGCGTTCCAGGAGACAGAGCGGCGATGGGGG
AGGCGGTGGTTTTGTTATTCCGGCGAAGAGGAAGATCCAGTATAGTTCGATGGTTGTGGTTGCGGCGGCGGGACCAAGCC
GGTGTGAGCCTGGAAGCAGTCTTAATGCGCCGCTTGAGCCACGATCGGCGCAGGGGAGGTTTCTGAGAAGCGTGTTGCTA
AACAAACGACAGCTATTTCATTACGCCGCCGCTGATGAGCTTAAGCAACTGGCTGATGATAGGGAAGCTGCTTTAGCTCG
TATGTCTCTCAGCTCTGGTTCCGATGAGGCTTCTCTCCACAGAAGGATAGCTCAACTCAAGGAACGTTACTGCAAAACTG
CAGTCCAAGACATAATGTACATGTTAATCTTTTACAAATACTCCGAGATAAGAGTCCCTCTTGTTCCAAAGCTATCCAGA
TGCATCTACAATGGACGACTCGAGATCTGGCCTTCAAAAGACTGGGAGTTAGAGTCGATTCACAGCTGCGATACCCTTGA
GATCATCAAAGAACACGTAAGCGCAGTCATCGGGTTACGGGTTAATTCATGTGTGACGGACAATTGGGCAACAACCCAGA
TACAGAAATTGCATCTCAGGAAAGTATACGCTGCCTCGATCTTGTACGGTTACTTCTTGAAATCGGCTTCCCTAAGGCAT
CAGCTTGAGTGTTCCTTATCAGATCTCCATGGAAGCGGATATCTGAAAAGTCCCATCCTTGGATGCTCTTTCACAACGAG
CACTGCACAGATCTCCAGCAAGCAGCAGCTGAGACATTACATCTCAGGCTTCGATCCCGAGACACTGCAGAGATGCGCAA
AACCAAGGACAGAGGAGGCAAGGAATCTGATAGAGAAGCAAAGTTTGGCCCTTTTTGGCACGGAAGAGAGTGATGAGACC
ATCGTGACATCGTTTTCGAGTTTGAAGCGGTTGGTTCTCGAGGCTGTGGCGTTTGGGACGTTCCTGTGGGACACGGAATT
GTATGTAGATGGTGCATATAAGCTCAAGGAGAATAATGGGAATGCAGAAGAACAAGAAGGAAAGAGAAGCATATGA