Details for Lyrate rockcress Locus 16055758

Position : sca3 ( 5`- 1478368 .. 1480061 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055758

Protein [Map View]
MVVHLISLLTQTLALIILSLPSIINTSQLDYDTLVFKQCDSLAPNIFQKTRPNYSNNILFLRAQALSSLLRKLESESSWS
KFFKTLVGNEEHAVSGWFQCREDYPNGICHKCVGALREISSRLCGNATSARIHLRGCHLIYKFERIDTPGALNNHHNYKL
FESPEHGLIHKICEGATAETLAGFEEMRAEALIAAETGVVDGHGFYEDSYKLLHVVAQCDGHVEACDCGECISSAAAAAA
EECRWSVAGQIYLEGCHVSYTYHPHELPNDSYHEEGSKVNTGKSLAIVVGGVAALVFVAIFFMFLKSLRKKGDDC*

DNA
ATGGTTGTCCACTTGATCTCTCTCCTCACACAAACCCTAGCCCTAATCATTCTATCTCTTCCCTCTATCATCAACACTTC
CCAATTGGATTACGATACTCTAGTTTTCAAACAATGCGATTCATTGGCCCCAAACATCTTCCAAAAAACAAGACCAAATT
ACTCGAATAATATTCTCTTTCTTCGTGCACAAGCCCTTTCTTCTCTCTTACGCAAACTCGAATCCGAATCCTCTTGGTCT
AAGTTCTTTAAGACTCTAGTTGGTAACGAAGAACACGCCGTCTCAGGATGGTTCCAATGCAGAGAAGATTATCCGAATGG
GATATGCCATAAATGTGTTGGTGCTCTTCGTGAGATTTCGTCTAGATTGTGTGGAAATGCCACGTCAGCTCGTATTCATC
TTCGAGGATGTCACTTGATATACAAATTCGAACGTATTGACACCCCTGGCGCTCTTAATAATCATCACAACTACAAGTTA
TTTGAGAGCCCGGAACACGGTCTCATCCACAAGATATGCGAGGGAGCTACCGCAGAGACTTTAGCCGGATTCGAAGAGAT
GAGGGCGGAGGCACTCATTGCAGCCGAAACAGGAGTCGTTGACGGGCACGGATTCTATGAGGATAGCTACAAGCTCCTCC
ACGTTGTGGCTCAATGCGACGGCCACGTTGAAGCTTGCGATTGCGGAGAGTGCATAAGTTCCGCGGCGGCGGCTGCAGCA
GAAGAGTGCCGGTGGTCTGTAGCCGGTCAAATATACTTAGAAGGGTGCCACGTCAGTTATACATATCACCCGCATGAACT
TCCCAATGATTCGTACCACGAAGAAGGTTCAAAAGTTAACACGGGGAAGTCGTTGGCGATAGTTGTAGGAGGAGTAGCGG
CATTGGTCTTTGTTGCTATCTTTTTTATGTTCCTAAAAAGCTTGCGTAAAAAAGGAGATGATTGTTGA