Details for Lyrate rockcress Locus 16055751

Position : sca5 ( 5`- 17949447 .. 17943515 -3` )
Annotation : [B2G] oxidoreductase [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055751

Protein [Map View]
MEALVCRKLGDPTATNLGNPESPVEVSKTHPIPSLNSDTAVRVRVIATSLNYANYLQILGKYQEKPPLPFIPGSDYSGIV
DAIGPAVTKLRVGDRVCSFADLGSFAQFIVADQSRLFLVPERCDMVAAAALPVAFGTSHVALVHRARLTSGQVLLVLGAA
GGVGLAAVQIGKVCGAIVIAVGRGTEKIQLLKSMGVDHVVDLGTENVISSVKEFIKTRKLRGVDVLYDPVGGKLTKESMK
VLKWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYRIHQPNVLEDSIKELLSWLSRGLITIHISHTYSLSQANL
AFGDLKDRKAIGKVMIALDHKTALSSKL*

DNA
ATGGAGGCTTTGGTTTGCCGGAAATTGGGAGATCCGACGGCGACGAATCTAGGTAATCCAGAATCTCCGGTGGAAGTAAG
CAAGACTCATCCGATCCCGTCTTTAAATTCAGACACGGCGGTGAGAGTCAGAGTTATCGCTACGAGCTTGAATTACGCTA
ATTACCTTCAGATTCTTGGAAAATACCAGGAGAAACCTCCGTTACCTTTTATCCCTGGCTCCGATTACTCCGGAATCGTC
GACGCGATTGGTCCCGCCGTCACCAAACTCCGCGTTGGAGATCGTGTCTGTTCTTTCGCCGATCTCGGTTCCTTCGCTCA
GTTTATCGTCGCTGATCAATCTCGTTTGTTCCTTGTACCGGAAAGATGTGACATGGTTGCTGCAGCTGCACTTCCTGTTG
CGTTTGGGACTTCTCATGTAGCACTTGTTCATAGAGCTCGTTTAACATCTGGTCAAGTCTTATTGGTTTTAGGTGCTGCT
GGTGGCGTTGGTCTTGCAGCTGTTCAAATCGGCAAGGTTTGTGGAGCCATTGTCATTGCAGTTGGTAGAGGAACTGAGAA
GATTCAGCTGTTGAAGTCAATGGGAGTGGATCATGTTGTTGATCTAGGCACTGAGAATGTTATTTCAAGTGTCAAAGAGT
TTATCAAGACAAGAAAGCTTAGAGGAGTTGATGTTTTGTATGATCCTGTGGGAGGGAAACTAACCAAGGAGTCCATGAAA
GTTCTGAAATGGGGAGCTCAGATTCTGGTGATAGGTTTCGCCAGCGGCGAAATACCTGTGATTCCTGCTAATATAGCACT
TGTTAAGAACTGGACGGTTCATGGTCTTTACTGGGGTAGCTACAGGATCCATCAGCCCAATGTCCTTGAAGATTCCATCA
AAGAGTTACTGTCATGGCTTTCCCGAGGATTGATCACTATTCACATCTCTCATACCTATAGCCTCTCCCAGGCCAATCTT
GCATTCGGGGACCTCAAAGACAGGAAGGCAATTGGAAAAGTGATGATTGCTCTCGACCACAAGACTGCCCTGTCTTCAAA
ACTATAG