Details for Lyrate rockcress Locus 16055717

Position : sca3 ( 5`- 5674198 .. 5676738 -3` )
Annotation : [B2G] metallo-beta-lactamase family protein
External links : CoGe
PGDD synteny : 16055717

Protein [Map View]
MAAMSAVLSLGLGTLRPSHRSLSCFDSLRHQTSFLRCHQSLISRNTKSPLNKILQACLQSNYANADALVSSSDKSSEIVF
MGTGTSEGIPRVSCLTNPLKTCSVCTKATEPGNKNRRLNTSILVRYIRPSGTSNILIDCGKFFYHSALRWFPTFGLRTLD
AVVITHSHADAIGGLDDLRDWTNNVQPHIPIYTAMRDLEVMKKTHYYLVDTSVIIPGAAVSELEFKIIHEDQPFVVNDLK
ITPLPVWHGSNYRSLGFRFGNVCYISDVSDIPEETYPLLKDCDLLIMDALRPDRSSATHFGLPRALEEVRKIKPKRTLFT
GMMHLMDHEKVSEELEKIRDTEGLDVQLSYDGLRVPISI*

DNA
ATGGCGGCTATGTCAGCGGTTCTGTCTCTGGGTTTAGGAACACTCCGCCCTTCGCATCGTTCCTTGTCCTGTTTCGATTC
TCTCCGGCACCAGACATCTTTTCTCCGTTGCCACCAAAGTCTCATCTCTAGAAATACGAAGTCTCCGCTCAACAAGATTC
TTCAGGCTTGCCTTCAATCCAACTATGCAAATGCTGATGCTTTGGTGTCATCATCCGATAAAAGTTCTGAGATTGTATTT
ATGGGTACTGGAACCAGTGAAGGGATTCCTCGTGTTAGCTGCCTCACTAATCCTTTGAAAACATGTTCGGTATGCACAAA
AGCAACAGAACCAGGAAACAAAAATAGGAGGCTTAACACCAGCATTCTTGTTCGGTACATTAGACCATCAGGAACAAGTA
ACATCCTAATTGATTGTGGCAAGTTCTTCTACCATAGTGCCCTTCGATGGTTTCCCACCTTCGGGCTAAGAACACTTGAT
GCAGTTGTAATTACTCATTCTCATGCTGACGCAATTGGAGGTCTTGATGATCTCCGTGATTGGACAAACAATGTTCAACC
TCACATTCCAATTTACACTGCTATGCGTGATCTCGAGGTGATGAAGAAGACCCATTATTACTTGGTTGATACGAGTGTCA
TCATACCCGGAGCTGCAGTCTCAGAGTTGGAGTTTAAAATCATACACGAGGACCAACCATTTGTGGTAAACGATCTAAAG
ATCACCCCATTACCTGTATGGCATGGAAGTAACTACCGTTCCCTTGGTTTCCGATTTGGTAACGTCTGCTACATAAGCGA
TGTCAGTGACATACCGGAAGAAACCTACCCACTCCTTAAAGACTGTGATCTCCTAATTATGGATGCTTTGAGGCCTGACC
GGTCTTCAGCAACACACTTTGGCCTCCCAAGAGCGTTAGAGGAAGTTCGGAAAATCAAACCAAAAAGAACTCTTTTCACC
GGAATGATGCACTTGATGGACCACGAGAAGGTGAGCGAAGAACTAGAGAAAATTAGGGACACAGAAGGCCTCGATGTCCA
ATTGAGTTACGATGGTCTTCGTGTTCCAATCTCAATTTAA