Details for Lyrate rockcress Locus 16055708

Position : sca3 ( 5`- 6617556 .. 6616276 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479026 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055708

Protein [Map View]
MGFIGETVDSIKSIKIRQLLTQAITLGMIVTSALIIWKALICVTGSESPVVVVLSESMEPGFQRGDILFLRMTDEPIRAG
EIVVFSVDGREIPIVHRAIKVHERGDTKEVDVLTKGDNNDIDDIGLYAEGQLWLHRHHIMGRAVGFLPYVGWVTIIMTEK
PIIKYILIGALGLLVITSKD*

DNA
ATGGGTTTCATCGGAGAAACTGTAGATTCCATTAAATCTATCAAGATCCGTCAGCTTCTCACTCAGGCTATCACTCTCGG
TATGATCGTTACATCTGCATTGATAATTTGGAAGGCATTGATATGTGTCACTGGCAGTGAATCACCTGTGGTTGTTGTTC
TCTCAGAAAGCATGGAACCTGGCTTTCAGAGAGGGGATATATTGTTCTTGCGGATGACCGATGAGCCTATTCGAGCAGGG
GAGATTGTTGTTTTTAGTGTTGATGGTCGTGAAATTCCCATTGTTCATCGAGCAATCAAAGTTCATGAGAGGGGAGATAC
TAAAGAAGTTGATGTTCTAACAAAAGGTGACAACAATGACATTGATGACATCGGTCTCTATGCTGAAGGACAACTTTGGC
TTCATAGGCACCATATCATGGGCAGAGCTGTTGGGTTCTTGCCTTATGTTGGATGGGTAACTATTATCATGACAGAAAAG
CCTATCATCAAGTATATACTCATTGGTGCATTGGGTTTGCTCGTTATAACATCCAAAGACTAA