Details for Lyrate rockcress Locus 16055683

Position : sca3 ( 5`- 935790 .. 933712 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055683

Protein [Map View]
MDFHCLPRRDLQFFCKRNKIPANMTNIAMADALRDLEIVEGMDEFMDPSRDQSPTSVARNLPSAARTAARTTRRKTTKDE
TQSSELVTRSCYVVSKSLAGEMDQENKNMNMLQNPSVPQSLAVKLDVTDMMPEANVSKTPAARSTRRAQAAASSKKDESV
QRVYSTRRSVRLLEESMADLSLKTNVPAKKHEDSPAGSKFQEKSDENSENTEKGGVMSVRDLNDSLEKEWDGSKNDPDID
ILYGDLGDITFFDASTSKEQMNGTDSSTVSASDSFVLVNEQETSKEDGFVVVDHAASTTTTNTLACYKEAESEQMRIDSE
SESEETEYETDPWEGDDFGVAVDTNQEAFESEVRASDNVSKVDSVTTVLIADESKELDFSPSPLAEEELEVDSDEWSDYE
IGEVELEENSCASEESIDIESEEAPGLDKKTPASSSSSSLAGNETKTSLSPFEAESILESDKDKEMAVNNNEEGKAEAEV
KKTKKKKKTIDEELRDVSMRQLTKMVKELAIKSKQQHKGPE*

DNA
ATGGATTTCCACTGTCTTCCGAGAAGAGATCTTCAATTTTTCTGTAAGAGAAACAAAATCCCAGCCAATATGACCAATAT
CGCCATGGCTGATGCTCTCAGAGATCTTGAGATTGTGGAAGGTATGGATGAGTTCATGGATCCATCTCGTGACCAGTCTC
CAACCAGTGTAGCTAGAAATTTGCCAAGTGCTGCTCGTACTGCAGCTAGAACAACTCGAAGGAAGACCACGAAAGATGAA
ACTCAGTCATCAGAATTGGTGACCCGTTCTTGTTATGTGGTGAGCAAGTCCTTAGCTGGAGAAATGGATCAAGAAAACAA
AAACATGAATATGCTCCAGAATCCATCAGTACCTCAGAGCCTTGCTGTGAAGTTAGATGTCACTGATATGATGCCTGAAG
CCAATGTGAGCAAAACTCCAGCTGCGAGAAGCACAAGAAGGGCTCAGGCAGCTGCATCCTCCAAGAAGGATGAGTCGGTT
CAGAGGGTGTACAGCACCAGAAGGTCTGTCAGATTGTTAGAAGAATCTATGGCTGACCTGAGTTTGAAAACCAATGTACC
TGCAAAGAAGCACGAAGATTCTCCAGCAGGTTCCAAATTCCAGGAAAAGTCAGATGAAAACTCAGAAAATACTGAGAAGG
GTGGAGTAATGTCAGTGAGAGATTTAAATGATTCGTTGGAGAAGGAATGGGATGGTTCAAAGAATGATCCAGATATTGAT
ATATTATATGGTGATCTTGGAGATATCACTTTCTTTGATGCATCTACCAGTAAGGAACAGATGAATGGAACAGATTCCAG
CACGGTTTCAGCTTCCGATAGTTTTGTTCTAGTCAATGAACAAGAAACTTCGAAGGAGGATGGTTTTGTCGTTGTCGACC
ATGCTGCTTCTACTACCACCACAAACACTTTAGCTTGCTACAAAGAAGCAGAGTCTGAGCAAATGAGGATTGATTCTGAA
TCTGAATCAGAGGAAACAGAATATGAAACTGATCCATGGGAGGGTGATGATTTTGGTGTTGCTGTTGACACGAACCAAGA
GGCATTTGAGTCTGAAGTCCGTGCTAGTGATAATGTGAGTAAAGTTGACTCAGTCACAACAGTTCTGATAGCTGATGAAT
CGAAAGAACTTGATTTTTCTCCTTCACCTCTTGCTGAGGAGGAACTCGAAGTAGACAGCGATGAATGGTCTGATTACGAG
ATAGGCGAGGTTGAGTTGGAGGAAAACAGTTGCGCATCTGAAGAATCGATTGATATTGAATCAGAAGAGGCTCCTGGTTT
AGATAAGAAGACTCCAGCTTCTTCTTCTTCCTCAAGTCTTGCTGGTAATGAGACAAAAACTTCGTTGTCTCCATTTGAAG
CAGAATCAATCTTAGAGAGCGACAAGGACAAGGAGATGGCTGTTAACAACAATGAAGAGGGGAAAGCGGAGGCCGAGGTT
AAGAAGACAAAGAAGAAGAAGAAGACGATTGATGAAGAGCTCAGAGATGTGAGCATGAGGCAACTAACGAAGATGGTGAA
AGAACTTGCTATTAAGAGTAAGCAACAACACAAGGGTCCTGAGTAA