Details for Lyrate rockcress Locus 16055668

Position : sca3 ( 5`- 2197982 .. 2196205 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055668

Protein [Map View]
MDSDSWSDRLASATRRYQLAFPPRSDTFLGFEEIDGEEEFREEFACPFCSDYFDSVSLCCHIDEDHPMEAKNVVCPVCAV
RVGVDMVAHITLQHANIFKMHRKRKSRRGGSHSTLSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFISPIA
EGFFTTESCISAETGSVKKPLTQSIPEGNAKIPSLSAEDHKQKLKRSEFVRELLSSTILDDGL*

DNA
ATGGATTCTGATTCATGGAGTGATCGTCTTGCTTCAGCTACAAGGAGATACCAGCTAGCTTTTCCACCACGATCTGATAC
ATTCTTAGGGTTTGAAGAGATAGATGGGGAAGAAGAGTTCAGGGAAGAGTTTGCTTGCCCTTTCTGTTCTGACTATTTTG
ATAGTGTGTCTCTCTGCTGCCACATAGATGAAGATCATCCTATGGAAGCCAAAAATGTGGTATGTCCAGTTTGTGCGGTT
AGGGTGGGTGTTGACATGGTTGCTCATATAACCCTTCAACATGCTAATATATTCAAGATGCACCGCAAGAGAAAATCAAG
AAGAGGCGGGTCACATTCCACGTTATCGATCTTAAGGAGAGAGTTTCCTGATGGAAACTTTCAGAGCCTATTTGGAGGAT
CTTCGTGTATAGTATCTTCTTCCTCATCATCCAATGTAGCGGCTGACCCATTGTTATCGTCGTTCATTTCACCTATTGCT
GAAGGGTTCTTCACAACGGAGTCATGTATATCTGCAGAAACCGGTTCTGTCAAGAAACCATTAACTCAGAGTATACCTGA
AGGGAATGCAAAAATACCGTCTCTTTCAGCTGAGGATCATAAGCAGAAGTTGAAACGCAGTGAGTTTGTTCGAGAGCTGT
TGAGCTCTACGATTCTTGATGACGGCTTATAA