Details for Lyrate rockcress Locus 16055663

Position : sca3 ( 5`- 8317128 .. 8314174 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479443 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055663

Protein [Map View]
MGVFSNLRGPKIGSTHEELPVANGSSSSSSTSSFKRKVSTFLPICVALVIIIEIGFLCRLDNASLVDTLTHFFTKSSSDL
KVGSGMEKCQEWLERVDSVTYSRDFSKNPIFIAGGNKDFESCSVDCVMGFSSDRKPDAAFGLSHQPGTLSIIRSMESAQY
YQENNLAQARRRGYDVVMTTSLSSDVPVGYFSWAEYDIMAPVHPKTEKALAAAFISNCAARNFRLQALEALMEANVKIDS
YGGCHRNRDGSVEKVEALKHYKFSLAFENTNEEDYVTEKFFQSLVAGSVPVVVGAPNIEEFAPSPDSFLHIKQMDDVKAV
AKKMKYLADNPDAYTQTLRWKHKGPSDSFKALIDMADVHSSCRLCIFVATRIREQEEKSPEFKRRPCKCTRGSQTVYHLY
VRERGRFDMESIFLKDGNLTLEALKSAVLAKFKSLRHEPIWEKERPVTLRGDGELRVHGIYPLGLTQRQALYNFKFEGNS
SLSTHIQRNPCPKFEVVFV*

DNA
ATGGGTGTTTTCTCCAATCTCCGAGGTCCTAAAATTGGATCGACCCATGAAGAATTGCCTGTAGCCAATGGCTCTTCTTC
TTCTTCGTCTACTTCCTCTTTCAAGCGTAAAGTCTCGACCTTTTTGCCAATCTGCGTGGCTCTGGTTATCATCATCGAGA
TCGGGTTCCTGTGTCGGCTCGATAACGCTTCTTTGGTCGATACGTTGACCCATTTTTTCACCAAGTCGTCGTCCGATTTG
AAAGTTGGGTCGGGAATGGAAAAATGCCAGGAGTGGTTAGAGAGAGTGGATTCAGTGACTTATTCTAGAGATTTCAGTAA
AAATCCAATCTTTATTGCTGGTGGTAACAAGGACTTCGAATCGTGTTCTGTTGATTGTGTTATGGGATTCAGTTCAGATA
GGAAACCCGATGCGGCGTTTGGATTAAGTCATCAACCTGGAACACTCAGTATAATCCGTTCCATGGAATCGGCACAGTAC
TACCAAGAGAACAATCTTGCTCAAGCACGACGGAGGGGTTATGATGTTGTGATGACAACTAGTCTGTCATCAGATGTTCC
TGTTGGGTATTTTTCATGGGCGGAATATGATATTATGGCTCCAGTGCATCCAAAGACCGAGAAAGCTCTTGCTGCTGCTT
TTATATCCAATTGTGCGGCTCGGAATTTCCGCCTGCAAGCTCTTGAAGCCTTAATGGAGGCGAATGTTAAGATTGATTCT
TATGGTGGTTGTCACCGGAATCGGGATGGGAGTGTGGAGAAGGTTGAAGCTCTTAAGCACTACAAATTCAGTCTAGCTTT
TGAGAACACCAACGAGGAGGATTACGTCACAGAGAAGTTCTTCCAATCGCTAGTTGCTGGATCTGTCCCTGTGGTTGTTG
GAGCTCCAAATATAGAAGAATTTGCACCTTCTCCTGACTCATTTCTTCACATTAAGCAGATGGATGATGTCAAGGCAGTT
GCAAAGAAAATGAAGTATCTTGCGGATAACCCTGACGCCTATACTCAGACGCTAAGATGGAAACACAAAGGCCCTTCAGA
TTCTTTTAAGGCACTTATTGATATGGCTGATGTACACTCTTCTTGTCGTCTCTGCATCTTTGTGGCTACAAGGATTCGTG
AGCAAGAAGAGAAGAGCCCTGAGTTTAAGAGACGACCCTGCAAATGCACCAGGGGCTCACAGACAGTTTATCATTTGTAT
GTTAGAGAAAGAGGGCGGTTTGACATGGAATCCATCTTCTTGAAGGATGGAAATCTGACTCTGGAAGCTCTGAAATCTGC
AGTACTTGCAAAGTTCAAGTCTCTGAGACATGAACCGATATGGGAGAAGGAAAGACCCGTGACCTTAAGAGGAGACGGTG
AGCTTAGAGTACATGGGATATATCCGCTTGGTCTGACTCAAAGACAAGCCCTTTACAACTTCAAATTCGAAGGAAATTCA
AGTCTCAGTACTCACATACAGAGAAACCCTTGTCCCAAATTCGAAGTTGTCTTTGTCTAA