Details for Lyrate rockcress Locus 16055653

Position : sca3 ( 5`- 546319 .. 544877 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477461 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055653

Protein [Map View]
MAARKKRAAKSSEDSEEEQSRRQRFQAILLADNFTTKLLPLTLERPNVLLPLVNVPMIDYTLAWLESAGLEEVFVFCSTQ
VIDYLNNSGWYSHKDFTVKTIESPHKSTSAGDALRYIYEQQIDTSQIQDDDFVLVSGGIVSNMPLTQLIQEHRDRKKKDD
KAIMTMVITDHQFFIGVNPLTKQLLYYNEDKIFLDTSLMDRNPSVLLCSDMQDCYIDICSLEMLSHFVDNCDYQHLRCDF
VEGVLADDITGFKIFTHEISSCYAARIENFRSYDMVSKDIIQRRTFPYVPDMKLSGNCSLKLGRQGSYKASDAIRSPSVH
VGDSSVIGHAKKIGTIFYSMMKLAADTPHSSDINLYKNTASIITRWKGLLGFYVKQIDEQIEVISRLEEMCQESAHELGP
LFAHIYNILFELMNLTKKHLMMKMT

DNA
ATGGCTGCTCGGAAGAAACGTGCGGCGAAGAGTTCAGAGGATTCAGAGGAGGAACAGAGTCGTCGTCAACGGTTTCAAGC
CATTCTTCTAGCTGACAACTTCACCACGAAACTTCTTCCCTTAACCTTAGAACGCCCCAATGTATTGTTACCGCTAGTGA
ATGTTCCCATGATCGATTACACCTTAGCTTGGCTCGAATCTGCTGGACTAGAAGAAGTTTTCGTCTTTTGCTCGACGCAA
GTCATCGATTATCTGAACAACTCTGGATGGTACTCGCACAAAGACTTTACGGTGAAAACGATAGAGTCACCGCACAAATC
CACTAGTGCTGGTGATGCTTTGCGTTATATCTATGAGCAACAGATTGACACGTCTCAGATTCAAGATGACGACTTTGTTC
TTGTTAGTGGAGGTATTGTGAGTAACATGCCCCTAACGCAGCTGATTCAAGAACACAGAGATAGAAAGAAGAAAGATGAT
AAAGCTATCATGACTATGGTTATCACGGATCATCAATTCTTCATCGGTGTAAATCCTTTAACAAAACAACTTCTTTATTA
CAATGAGGACAAGATCTTCTTGGATACGTCATTGATGGATCGTAATCCATCTGTTTTGCTATGTAGTGATATGCAGGATT
GTTACATTGACATATGTTCTCTTGAGATGCTTAGTCACTTTGTGGATAACTGCGATTACCAACATCTGCGTTGTGATTTT
GTGGAAGGTGTTCTTGCTGATGATATTACGGGTTTCAAGATTTTCACTCATGAGATCAGCTCGTGTTATGCTGCTAGGAT
TGAAAACTTCCGGAGCTATGACATGGTTAGCAAGGATATAATCCAGAGGCGGACATTCCCGTATGTACCGGATATGAAGT
TGAGCGGAAATTGTTCTCTTAAGCTCGGGAGACAAGGGAGCTATAAGGCTTCTGATGCTATCCGGTCACCATCTGTTCAT
GTTGGAGATTCCTCTGTCATTGGACATGCCAAAAAGATTGGGACAATATTCTACTCTATGATGAAACTAGCAGCTGATAC
TCCACATAGCTCTGATATTAACTTGTATAAAAATACGGCGAGTATCATTACTCGATGGAAGGGACTTCTTGGGTTCTATG
TAAAGCAAATTGACGAACAGATAGAAGTAATATCGAGATTGGAAGAGATGTGTCAAGAATCTGCGCATGAGTTGGGACCT
TTGTTTGCTCATATATATAATATATTATTCGAGCTGATGAATCTGACAAAGAAACATCTGATGATGAAGATGACTGA