Details for Lyrate rockcress Locus 16055651

Position : sca3 ( 5`- 8284600 .. 8278586 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479436 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16055651

Protein [Map View]
MEEEDEEILSSSDCDDSSDSYKDDSQDSEGENENPDCEDLAVVSPSSDADRKSKNVNDLLRGNLVVQRQPLLPRVLSVSE
GAAVCRKPFKPPCSHGYNSTGKLSRRLSARKRFVPWGSSTPVVVALPTKLEASTNIEKDEEEEVVCLPPDIEPLILWQSE
EDGMSNVTTIMVHSLLVQFLRPHQREGVQFMFDCVSGLHGSENINGCILADDMGFGKTLQSITLLYTLLCQGFDGTPMVK
KAIIVTPTSLVSNWEAEIKKWVGDRIQLIALCESTRDDVLSGIDSFTRPRSALQVLIISYETFRMHSSKFCQSESCDLLI
CDEAHRLKNDQTLTNRALASLTCKRRVLLSGTPMQNDLEEFFAMVNFTNPGSLGDAAHFRHYYEAPIICGREPTATEEEK
NLAADRSAELSSKVNQFILRRTNALLSNHLPPKIIEVVCCKMTTLQSTLYNHFISSKNLKRALADNAKQTKVLAYITALK
KLCNHPKLIYDTIKSGSPGTVGFENCLEFFPAEMFSGRSGAWTGGDGAWVELSGKMHVLSRLLANLRRKTNDRIVLVSNY
TQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNRLNDPTKDEFAFLLSSKAGGCGLNLIGANRLVLFDPDWNPANDKQ
AAARVWRDGQKKRVYVYRFLSTGTIEEKVYQRQMSKEGLQKVIQHEQTDNNTRQGNLLSTEDLRDLFSFHGDVRSEIHEK
MSCNRCQNDSAGTENIEEGNENNVDDNACQIDQEDIGGFAKDAGCYNLLKNSEKQVGTPLEEDLGSWGHHFTSKSVPDAI
LQASTGDEVTFVFTNQVDGKLVPIESNVSPKMVESEEHNRNQTVNKRAFNKPQQRPREPLQPLSLNETTKRVKLSTYKRL
HGTSNIDDAQIKMSLQRPNQVSVNHDDDFV*

DNA
ATGGAGGAAGAAGATGAAGAGATCTTATCGTCTTCCGATTGCGACGATTCCAGCGATAGCTACAAGGATGATTCTCAAGA
TTCGGAAGGAGAAAACGAAAACCCTGACTGCGAAGACCTGGCGGTGGTTTCTCCTTCATCCGACGCCGATCGGAAATCTA
AGAACGTCAATGATCTTTTGAGGGGTAATCTAGTTGTGCAACGGCAGCCACTCCTTCCTCGGGTGCTTTCGGTTTCAGAA
GGAGCGGCAGTTTGTAGGAAGCCCTTTAAGCCTCCGTGTTCTCATGGTTATAATTCCACTGGAAAACTTTCTCGTCGCCT
TTCAGCTCGAAAACGGTTTGTCCCTTGGGGTTCCTCAACTCCTGTTGTGGTTGCTTTACCTACTAAGCTAGAAGCATCAA
CCAATATTGAGAAAGATGAAGAAGAGGAAGTTGTTTGTCTGCCACCTGATATTGAACCCTTGATATTGTGGCAATCTGAA
GAAGATGGAATGAGCAATGTAACAACAATCATGGTGCATTCATTGCTTGTCCAATTTCTTCGCCCTCATCAAAGAGAGGG
TGTCCAGTTCATGTTCGATTGTGTTTCAGGATTACATGGTTCGGAAAATATAAATGGTTGCATTCTGGCTGATGATATGG
GTTTTGGGAAGACATTGCAGTCCATTACTTTACTATACACACTTCTTTGTCAAGGATTTGATGGGACGCCTATGGTTAAA
AAGGCCATTATTGTTACTCCAACGAGTCTTGTCAGTAACTGGGAAGCTGAAATTAAGAAATGGGTTGGAGACAGGATCCA
GCTTATAGCCCTCTGTGAAAGCACCAGAGATGACGTTTTGTCTGGAATAGATAGTTTCACTCGACCACGAAGCGCTTTGC
AGGTACTTATCATTTCTTACGAGACATTCCGAATGCACTCATCCAAGTTCTGCCAGAGTGAATCCTGTGATCTTCTAATA
TGCGATGAGGCTCATAGGTTGAAAAATGACCAGACACTAACTAACAGGGCTTTGGCTTCATTGACATGCAAACGTCGGGT
TTTGTTGTCTGGAACTCCCATGCAGAATGACTTGGAAGAGTTTTTTGCCATGGTCAACTTTACAAATCCAGGGAGTTTAG
GTGATGCTGCTCATTTTCGCCATTATTATGAGGCACCTATAATATGTGGAAGAGAACCTACAGCCACTGAGGAAGAGAAA
AATTTAGCTGCTGACCGCTCCGCAGAACTGAGTTCAAAAGTCAATCAGTTTATTTTGAGGAGAACCAATGCATTGCTCTC
AAATCACTTACCACCCAAGATAATTGAAGTAGTTTGTTGCAAGATGACGACTCTCCAGTCCACTTTGTACAACCATTTTA
TTAGCTCAAAAAATCTTAAAAGAGCACTTGCTGATAATGCAAAACAAACCAAAGTTTTGGCTTATATAACAGCTCTTAAG
AAGCTCTGCAATCATCCAAAGCTAATCTACGATACAATAAAAAGCGGCAGTCCTGGAACTGTTGGGTTCGAGAATTGCTT
AGAGTTTTTCCCTGCAGAAATGTTCTCTGGGAGATCTGGAGCATGGACTGGGGGTGATGGTGCCTGGGTTGAGCTCTCTG
GGAAAATGCACGTTCTCTCCAGACTTTTGGCCAACCTACGTCGAAAAACCAATGACCGCATAGTCCTTGTATCAAACTAC
ACACAGACATTGGATCTTTTCGCTCAACTCTGTCGTGAAAGAAGATATCCTTTTCTGAGGCTGGATGGATCAACAACAAT
CAGCAAGAGGCAGAAGCTTGTTAACCGGTTGAACGACCCAACAAAGGATGAGTTTGCATTTCTTTTAAGCAGCAAGGCGG
GTGGCTGTGGATTAAATTTAATCGGTGCTAATCGACTTGTTTTGTTCGATCCCGATTGGAATCCTGCCAATGATAAACAA
GCTGCTGCTAGAGTTTGGAGGGATGGGCAAAAGAAAAGAGTATATGTATACAGGTTTCTTAGTACTGGAACTATTGAAGA
AAAGGTTTACCAGCGCCAGATGTCAAAGGAAGGGCTTCAAAAAGTTATTCAGCATGAACAGACGGATAACAACACGAGAC
AGGGGAACTTACTTTCTACAGAGGATCTACGAGATTTATTTTCTTTCCATGGGGATGTTAGGTCTGAAATCCATGAAAAG
ATGAGCTGCAATAGGTGCCAAAATGATTCCGCTGGTACTGAAAACATCGAAGAAGGAAATGAGAACAACGTAGATGACAA
TGCTTGCCAGATTGACCAAGAAGACATAGGCGGATTTGCAAAAGATGCAGGATGCTATAACTTGTTAAAAAACTCTGAAA
AACAGGTGGGCACTCCATTGGAAGAAGATCTAGGAAGCTGGGGTCATCACTTTACCTCAAAGTCTGTTCCGGATGCTATA
CTGCAAGCTTCAACAGGTGATGAGGTTACGTTTGTTTTCACAAACCAGGTAGATGGGAAGCTCGTTCCCATCGAATCAAA
TGTCAGTCCAAAAATGGTGGAGTCCGAAGAGCACAATCGGAACCAAACTGTAAATAAGCGTGCCTTTAACAAACCACAAC
AAAGACCTCGGGAACCGCTGCAACCGTTGTCTCTCAACGAGACCACAAAAAGAGTGAAGTTGTCTACTTATAAGCGTTTA
CATGGTACTAGTAACATTGATGATGCTCAGATTAAAATGTCTTTGCAAAGACCAAATCAAGTTTCTGTAAATCACGATGA
TGATTTTGTATGA