Details for Lyrate rockcress Locus 16055649

Position : sca3 ( 5`- 6544243 .. 6544449 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16055649

Protein [Map View]
MVCFCFLVDQKRKIKGSKPAAGTCSRCGCGARIADMKTSTRFCLIPIYCRSWRAIICCFCGSVLKSYR*

DNA
ATGGTGTGTTTCTGTTTCTTGGTGGACCAGAAGAGGAAAATAAAAGGAAGCAAACCGGCGGCAGGAACGTGTTCCCGGTG
TGGTTGTGGTGCAAGAATCGCCGACATGAAGACTTCGACGAGGTTCTGTCTTATACCAATTTATTGCAGATCTTGGAGAG
CCATCATCTGCTGCTTTTGCGGCTCTGTTCTTAAATCGTACCGTTGA